KEGG   Cronobacter muytjensii: AFK63_09485Help
Entry
AFK63_09485       CDS       T04067                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK63_09485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmw02000]
    AFK63_09485
Enzymes [BR:cmw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFK63_09485
Transporters [BR:cmw02000]
 Other Transporters
  Pores ion channels [TC:1]
   AFK63_09485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ALB70831
LinkDB All DBs
Position
2041420..2042028
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIMLREAGIDFTLVAVDLAAKRTESGEDYLTINPKGQVPALLLDDG
TLLTEGVAIVQYIADKVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFDYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YQARVKARPAVAAALKAEGLGA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttttacaaagccggcgcatgttcactctcgccgcatatcatgctgcgcgaa
gcgggtatcgattttacgctggtggcggtggatctggccgcgaagcgcaccgaaagcggc
gaagattacctgactatcaacccgaaaggtcaggtgccggcgctgctgctggatgacggt
acgctgctgacggagggtgtcgctattgttcagtatatcgcggataaagtgccggaccgc
cagttgcttgcgccggtcggcagcatgacccgctaccatacgctggagtggctcaactat
atcgcgacggagctgcataaaggctttacgcctctgttccgtccggatacgccggacgag
tacaaaaccatcgcccgcgctcagctgcagaagaaattcgattatgtgaatgaggcgctg
gcgcagaagcagtggctgatggggctgcgcttcagcgtggcggatgcttacctgtttacg
gtgctgaactgggcaaaagcggtagggcttgagatgcaggcgtttgacaatatcgctgac
tatcaggctcgcgtgaaggcgcgtcctgctgttgcagcagcgctgaaggcggaaggtctg
ggcgcgtaa

DBGET integrated database retrieval system