KEGG   Cronobacter muytjensii: AFK63_13860Help
Entry
AFK63_13860       CDS       T04067                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00473  D-Alanine metabolism
cmw00550  Peptidoglycan biosynthesis
cmw01100  Metabolic pathways
cmw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFK63_13860
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFK63_13860
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AFK63_13860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cmw01011]
    AFK63_13860
Enzymes [BR:cmw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AFK63_13860
Peptidoglycan biosynthesis and degradation proteins [BR:cmw01011]
 Precursor biosynthesis
  Amino acid ligase
   AFK63_13860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ALB71647
LinkDB All DBs
Position
2990490..2991590
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKEKFDVVLLGIDKQGQWHVNDASHYLLN
ADNPARIALHRSEKNVALIPGQQAQQLIDSDNRQALPQLDVIFPIVHGTLGEDGSLQGML
RMANIPFVGAGVLGSAVSMDKDVAKRLLRDAGLAVAPFITLTRANRQRITFAEVKAQLGL
PLFVKPANQGSSVGVSKVNDEAQFHAAVALAFEFDHKVVVETGIQGREIECAVLGNEDPQ
ASTCGEIVVNSEFYSYDTKYIDDQAARVVVPADIAPEINEKIRAIAVRAFQALECAGLAR
VDVFLTPENEVIINEINTLPGFTNISMYPKLWQASGIGYQALITRLIELALERHRADASL
KSSITG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgcgtgggcattgtgtttggcggaaaatcggcggagcacgaagtgtcg
cttcagtcggcgaaaaatatcgtcgatgcgattgataaagaaaaattcgacgtggtgctg
cttggcattgataaacaaggccagtggcatgttaacgacgcgtcgcactatctgctgaat
gccgataacccggcgcgcatcgccctgcaccgctcggagaaaaacgtcgcgctgatcccg
ggccagcaagcgcagcagctgattgattctgacaaccgccaggcgctgccgcaactggat
gtgattttccccatcgttcacggcacgctcggcgaagatggttccctgcaagggatgctg
cgcatggcaaatattccgtttgtcggcgcaggcgtgctgggttcggcggtcagcatggat
aaagacgtcgccaagcgactgctgcgcgacgccggtctcgccgtcgcgccgtttattacc
cttacccgcgcaaaccgccagcgcatcaccttcgccgaggttaaagcgcagctgggcctg
ccgctgttcgtcaaaccggcgaaccagggctcatcggtcggcgtcagtaaagtcaacgac
gaggcgcagttccacgccgccgtggcgctggcctttgaattcgatcataaagtggtggtg
gaaaccggcattcagggccgtgagatcgagtgcgcggtgctgggcaacgaggatcctcag
gcgagcacctgcggcgagatcgtggtcaacagcgagttttactcttacgacaccaaatac
atcgacgatcaggccgcccgcgtggtggtgcctgccgatatcgcgcctgagatcaacgag
aagatccgagccatcgccgtgcgcgcgtttcaggcgctggagtgcgctggcctcgcgcgc
gtggacgttttcctgacgccggaaaacgaggtgattattaatgagatcaacacgctgccg
ggctttaccaatatcagtatgtatccgaaactgtggcaggcgagcggcatcggttaccag
gcactgatcacccgcctgattgaactggcgctggagcgtcatcgcgccgacgcgtcgctg
aaaagctccatcaccggttaa

DBGET integrated database retrieval system