KEGG   Cronobacter muytjensii: AFK63_14565Help
Entry
AFK63_14565       CDS       T04067                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00061  Fatty acid biosynthesis
cmw00780  Biotin metabolism
cmw01100  Metabolic pathways
cmw01212  Fatty acid metabolism
Module
cmw_M00083  Fatty acid biosynthesis, elongation
cmw_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AFK63_14565
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AFK63_14565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmw01004]
    AFK63_14565
Enzymes [BR:cmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AFK63_14565
Lipid biosynthesis proteins [BR:cmw01004]
 Fatty acid synthase
  Component type
   AFK63_14565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ALB71775
LinkDB All DBs
Position
complement(3148119..3148574)
Genome map
AA seq 151 aa AA seqDB search
MTTETHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMVMEVTFEKT
RRGVTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgaaactcatactctgcacattgaagagattttagagcttctgccgcaccgt
tatccattcctgctggtggatcgcgtgctggattttgaggaaggtcgttttctacgcgca
gtaaaaaatgtctctgttaacgagccttttttccagggtcactttcctggtaaacccatt
tttccgggtgtgttgattttagaagccatggcgcaagccaccggtattctggctttcaaa
agcgttggcaaactggaaccgggtgaactttactattttgcaggcatcgatgaagcgcgc
tttaagcgtcctgtcgtgccaggcgaccagatggtgatggaagttacctttgaaaaaacg
cgccgtggagtcactcgcttcaaaggcgtcgcgctggttgacggtaaagtggtttgtgaa
gccaccatgatgtgtgcacggagccgggaggcctga

DBGET integrated database retrieval system