KEGG   Cronobacter muytjensii: AFK63_15740Help
Entry
AFK63_15740       CDS       T04067                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cmw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFK63_15740
Enzymes [BR:cmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AFK63_15740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ALB72000
UniProt: A0A0K2PGU8
LinkDB All DBs
Position
complement(3431138..3433198)
Genome map
AA seq 686 aa AA seqDB search
MNKFAPLSPKVSALLHGADYNPEQWEHYPGTVESDIAMMQQAKCNVMSVGIFSWAKLEPE
EGVFRFEWLDEIIDKLYQGGVHVFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTATINRLLAERYAHHPAVLGWHISNEYGGECHCGLCQENFRGWLKARYG
TLDKLNEAWWSTFWSHTFTDWSQIESPAPQGENSIHGLNLDWRRFNTAQVTDFCRHELAP
LKAVNPELPATTNFMEYFYDYDYWQLAEPLDFISWDSYPMWHRDKDETELACYTAMYHDL
MRTLKQGKPFVLMESTPGTTNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVAQLGDILSQLDPVVGARVDAQMAVIFDWESRWAMDDA
QGPRNLGLEYEKTVAEHYRPFWEQGIAVDIINADADLSRYKLVIAPMLYMVRDGFAQRVE
AFVEQGGHFVTTYWSGIVNDTDLCHLGGFPGPLRKLLGIWAEEIDCLAEGERNLIQGLAG
NEAGLQGPYQVRHLCDLIHTEGATALATYRDDFYAGRAAVTVNAFGAGKAWYVASRNDLA
FQRDFFANIINELSLPRALEADFPPGVTAHARQDGESAFIFVENYTGAPQSVTLPEGCAD
MLTGDAVSGKLPLAPWGCRILRRRLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgcgcctttaagtccgaaggtcagcgcccttttgcacggcgcggactac
aacccggagcagtgggaacactatcccggcaccgttgagagcgatatcgccatgatgcag
caggcgaaatgcaacgtcatgtcggtcggcattttcagctgggcgaagcttgagccggaa
gagggcgtgttccgcttcgagtggctcgatgagattatcgacaagctctatcagggcggc
gtgcatgtcttcctcgccacgccgagcggcgcgcgtcctgcatggatgtcgcagaaatac
ccgcaggtgctgcgcgtcgggcgcgaccgcgtaccggcgctgcacggcggtcgccataac
cactgcatgagctcgccggtctatcgggaaaaaaccgcgaccatcaaccgcctgctggcg
gagcgttacgcgcaccatccggcggtgctcggctggcatatctctaacgaatatggcggc
gaatgccactgcgggttgtgccaggagaatttccgcggctggctgaaggcgcgctacggc
acgctcgacaaactcaacgaggcctggtggagcaccttctggagccacacctttaccgac
tggtcgcagattgaatccccggcgccgcagggcgaaaactccattcacggcctgaatctg
gactggcggcgctttaacaccgcgcaggtgaccgatttctgccgtcacgaactggccccg
ctaaaggcggtgaacccggaattacctgcgaccactaacttcatggagtatttctacgat
tacgactactggcagcttgccgaaccgctcgattttatctcctgggacagctacccaatg
tggcaccgcgataaagacgaaaccgagctcgcctgctacacggccatgtatcacgacctg
atgcgcaccttaaaacaaggcaaaccgtttgtgctgatggagtcgacgccgggcaccacc
aactggcagcccaccagcaaactgaaaaagccggggatgcatattctctcttcactccag
gcggtggcgcacggcgcggattctgtgcagtacttccagtggcgtaaaagccgcggctcg
gtagagaaattccacggcgcggtggtggatcatgtcggccatatcgacacccgcatcggg
cgcgaagtggcgcagcttggcgatatcttaagccagctcgatccggtggtcggcgcgcgg
gtggacgcgcagatggcggtgattttcgactgggaaagccgctgggcgatggacgacgcg
cagggcccgcgcaacctggggctggagtatgaaaagacggtcgcagaacactaccggcct
ttctgggagcaggggatcgcggtcgatatcatcaacgccgacgccgatctcagccgctat
aaactcgttatcgccccgatgctctatatggtgcgcgacgggttcgcgcagcgcgttgag
gcatttgtcgaacagggcggccactttgtgacgacctactggagcggcatcgttaacgac
accgatctctgccatctgggcgggttccccggcccgctgcgtaagctgctgggcatctgg
gccgaagagatagactgccttgccgaaggcgaacgcaatctgattcaggggctggcgggc
aatgaagcggggctacaggggccgtatcaggtgcgccatctgtgcgatctgatccacacc
gaaggcgcgacggcgcttgcgacgtatcgcgatgatttctacgccggacgcgcggcggtg
accgttaacgcgtttggcgcgggcaaggcctggtatgtggcctcgcgtaacgacctcgcc
ttccagcgcgatttcttcgccaacattattaacgagctgtcgctgccacgcgcgctggag
gcggacttcccgccaggcgtcacggcgcacgcccgtcaggatggcgaatcggcgtttatt
ttcgttgaaaactacaccggcgcgccgcagtcggtgacgctgccggagggctgcgccgat
atgctgaccggcgacgccgtcagcggcaagctgccgctcgccccgtgggggtgccgcatt
ctgcgccgccgcctcgcctga

DBGET integrated database retrieval system