KEGG   Cronobacter muytjensii: AFK63_16220
Entry
AFK63_16220       CDS       T04067                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00052  Galactose metabolism
cmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFK63_16220
Enzymes [BR:cmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AFK63_16220
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 TrkA_N Methyltransf_25 UDPG_MGDP_dh_N MTS 3HCDH_N Pyr_redox_2 XdhC_C Methyltransf_31 Peptidase_U32 ELFV_dehydrog Met_10 Pyr_redox PrmA Shikimate_DH
Other DBs
NCBI-ProteinID: ALB72089
LinkDB
Position
3531513..3532556
AA seq 347 aa
MKSVVIDAEGSVRVEERPVPTVNADDEVLVKVVSSGLCGSDIPRIFARGAHYYPITLGHE
FSGYVERCGKGVSDLSPGDAVACVPLQPCFECEACARGYYSLCRHYQFVGSRSEGGHAEY
IVVRRASLFLLPPEMPVEDGAFIEPVTVGLHAFHQAQGCEGKNVVIVGAGTIGLLAMQCA
QALGANSVTAIDINPEKLRLAHALGADRVLNSRELSSQAISAALETQRFDQLVLETAGTP
QTVSLAIEIAGPRAQVALVGTLHHDLALSATVFGKILRNELTLLGSWMNYSAPWPGEEWE
TAARLLTEKRLSLKPLIAHQGDAESFVGAVQALNGAPMQGKILLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattgatgctgagggcagcgtgcgcgttgaagaacgccctgtgccc
actgtcaatgcggacgacgaggtgctggtaaaagtcgttagctcaggtttatgcggctcg
gacattccccgcattttcgcccgcggcgcgcactactatcccatcacgctgggccatgag
tttagcggctatgtggagcgctgcggcaagggcgtgagcgatctgtcgcctggcgatgcg
gtggcctgcgttccgctacagccctgctttgaatgtgaagcctgcgcccgcggttactat
tcactgtgtcggcactatcagtttgtaggctcccgcagcgagggcggccacgccgaatat
attgtggtcaggcgcgccagcctgtttcttctgccgccagagatgccggttgaagacggc
gcgtttatcgaacctgtcaccgtcgggctacacgcctttcatcaggcccagggatgtgaa
ggcaaaaacgttgtgatcgttggcgccggcacgattggtctgctggcgatgcagtgcgcg
caggcgctgggcgcgaacagcgtgacggccattgatatcaacccggaaaagctccgcctg
gcgcacgcgctcggggcggatcgggtattgaacagccgggagctgtcttcgcaggccatc
tccgctgcgctggagacgcagcgcttcgatcaactggtgctggaaaccgcgggtactccg
cagacggtatcactggcgatagaaatcgccgggccacgcgcgcaggtcgctctggtcggc
acgctgcatcatgaccttgcactctccgccacggtttttggcaaaattttgcgcaatgaa
ctgacgttactcggtagctggatgaactattctgcgccctggccaggtgaagaatgggaa
accgccgcgcggctgcttaccgaaaagcggctgtcgctcaagccgctgattgcgcatcag
ggagatgctgaaagcttcgtcggcgcagtccaggcgctgaacggcgcaccgatgcagggc
aaaatcctgctgcgattcgcctga

DBGET integrated database retrieval system