KEGG   Cronobacter muytjensii: AFK63_17560Help
Entry
AFK63_17560       CDS       T04067                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00620  Pyruvate metabolism
cmw00680  Methane metabolism
cmw01100  Metabolic pathways
cmw01120  Microbial metabolism in diverse environments
cmw01200  Carbon metabolism
Module
cmw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK63_17560
  09102 Energy metabolism
   00680 Methane metabolism
    AFK63_17560
Enzymes [BR:cmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AFK63_17560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALB72313
LinkDB All DBs
Position
3815108..3817759
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEADRQALLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEIIARTLRKLKDQPTINEN
AIRQAVEALSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDHKDIADYERNQIMRRLRQ
LIAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEAHLDYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLISELSMVECSDALR
DYVGTEGAQEPYRYLLKGLRAQLLATQGWLEARLKGQKLPKPQGLLTQNEQLWEPLYACY
QSLVSCGLGIIANGELLDTLRRVKAFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSDNTREVLDTCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAAWRHIMDEL
SDISCAMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQDELETMCRDWPFFSTRLGMLEMVFAKADLWLAD
YYDQRLVKPELWPLGQELRQLLEADIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKPADPCVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgaagcaatgtcagtatgctcggcaagttgctcggg
gataccatcaaggatgcgctgggagaaaacatccttgaccgcgtagaaacaatccgcaaa
ttgtcgaagtcttcccgtgctggcaatgaagcagaccgccaggcgctgttaaccacgctg
caaaatctttccaatgacgaactgctgccggtggcccgcgcgttcagccagttcctgaat
ctggctaacacggccgagcaataccacagcatctcgccaaaaggcgaggccgccagcaac
ccggaaattatcgcccgtaccctgcgtaagctcaaagaccagcccactatcaacgaaaac
gccatccgccaggccgtggaagcgctgtcgctggagctggtgctgaccgcgcacccgact
gaaatcacccgccgcaccctgatccacaaaatggtcgaagtgaataactgtttaaaacag
ctcgaccacaaagacattgccgattatgagcgcaaccagatcatgcgccgcctgcgccaa
ctgattgcgcagtcctggcatactgacgagatccgtaaaaatcgcccaagcccggtggat
gaagccaaatggggcttcgccgtggtggaaaacagcctctgggaaggcgtgccgaattat
ctgcgtgagcttaacgaacagctcgaagcgcatctcgattacaagctgccggtcgatttc
gtgccggtgcgtttcacttcctggatgggcggcgatcgcgacggcaacccgaatgtcacc
gccgatatcacccgccacgtcctgctgctgagccgctggaaagcaaccgatctgttcctg
aaagatatccaggtgctgatttccgagctctcaatggtggaatgcagcgacgcgctgcgc
gactacgttggcactgaaggggcgcaggagccgtaccgctatctgcttaaagggctgcgc
gcgcagctgctggcgactcagggctggctggaagcccgcctgaagggccagaaactgccg
aaaccgcagggcctgctgacgcagaacgaacagctctgggaaccgctctacgcctgctat
cagtcgctggtctcctgcgggcttgggatcatcgccaacggcgaactgctcgacaccctg
cgccgcgtcaaagcgttcggcgtgccgctggtgcgtatcgacatccgtcaggagagcacc
cgccacaccgaagcgctgggtgagctgacccgctatctcggcatcggcgactatgaaagc
tggtcggaagccgataaacaggcgttccttatccgcgagctgaattccaaacgcccgctg
ctgccgcgccagtgggagccgagcgacaacacccgcgaagtgctcgacacctgtaaagtc
atcgccgaagcgccgaaaggctcgatcgccgcttatgtcatctcgatggcgaaaacgccg
tccgacgtgctggccgtccacctgctgctgaaagaggcgggtattggcttcgcgctgccg
gtcgcgccgctgtttgaaacgctcgacgatctgaacaacgccaacgatgtcatgacccag
ttgctgaacatcgactggtatcgtggtttcattcagggcaaacagatggtgatgattggc
tattccgactccgcgaaagacgcgggcgtgatggccgcttcctgggcgcaataccaggcg
caggacgcgctcatcaaaacctgcgagaaagcgggcatcgcgctcacgctctttcatggt
cgcggcggctctattggccgcggcggcgcgcccgcccatgcggcgctgctctctcagccg
ccaggcagcctgaaaggcggtctgcgcgtcaccgaacagggcgagatgatccgctttaaa
tacggtctgccggaagtcaccatcagcagcctgtcgctctacaccagcgcgattctggaa
gcgaacctgctgccgccgccggagccgaaagccgcctggcgacacatcatggatgagctg
tccgatatctcctgcgccatgtaccgcggctacgtgcgcgaaaacaaagacttcgtgccg
tatttccgttcggctacgccggagcaggagctgggcaaactgccgctcggctcgcgtccg
gcgaagcgccgtccgaccggcggcgtggaatcgctgcgcgccattccgtggattttcgcc
tggacccagaaccgtctgatgctgcccgcctggcttggcgccggcgccgcgctgcaaaaa
gtggtcgaagacggtaagcaggacgagctggaaaccatgtgccgcgactggccgttcttc
tccacacgcctcggcatgctggagatggtctttgccaaagcggatctgtggctggcggac
tattacgatcagcgactggtgaaaccggagctctggccgctcggacaggagctgcgccag
ttgctggaagccgatatcaaagtggtgctcgatatcgccaacgactcgcacctgatggcg
gatctgccgtggattgccgagtccatccagctgcgtaacatctataccgacccgctgaac
gtgctgcaggcggagctgctgcaccgctcgcgccaggcggaagaagaaggcaagccagca
gacccatgcgtggagcaggcgctgatggtcaccatcgcgggcgtcgcggcgggtatgcgt
aacaccggctaa

DBGET integrated database retrieval system