KEGG   Cronobacter muytjensii: AFK63_18980Help
Entry
AFK63_18980       CDS       T04067                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00260  Glycine, serine and threonine metabolism
cmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFK63_18980 (tdh)
Enzymes [BR:cmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     AFK63_18980 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 FAD_binding_2 HI0933_like FAD_oxidored Pyr_redox_3 Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ALB72571
LinkDB All DBs
Position
4143440..4144465
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKPAEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGC
FAEYLVIPAFNAFKIPDNIPDELASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEFRLDLARKMGVTRAVNVATESLQDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWNKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFTIDDFQKGFDAMRSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattatcaaaactgaaaccggcagaaggcatctggatgaccgacgtgccggag
ccggaagtcggccataacgatctgctgattaaaattcgcaaaaccgcgatttgcggcacc
gacgtgcatatctataactgggacgagtggtcgcagaagacaattccggtaccgatggtc
gtcgggcatgaatatgtcggcgaagtcgtcggcatcggccaggaagtgaaaggctttaaa
atcggcgatcgcgtcagcggcgaaggtcatatcacctgcggccactgtcgtaactgccgc
ggcgggcgtacgcacctgtgccgcaacaccgttggcgtgggcgtgaatcgtccgggctgc
ttcgccgaatacctggtgatcccggcgttcaacgccttcaaaattccggacaatattccg
gacgagctggcctcgattttcgacccgttcggcaacgcggtacacaccgcgctctcgttt
gacctggtcggcgaagacgtgctggtctccggcgcgggcccgattggcatcatggcggcg
gcggtcgcgaagcacgtgggcgcgcgcaatgtggtgatcaccgatgtgaacgagttccgt
ctggatctcgcgcgcaaaatgggcgtgacccgcgcggtgaacgtcgcgaccgaaagcctg
caggacgttatggccgaactgggcatgaccgaaggctttgacgtaggtctggagatgtcc
ggcgcgccgccggcgtttcgtaccatgctggacaccatgaaccacggcgggcgtatcgca
atgctcggcattccgccttccgatatgtccatcgactggaacaaagtcatctttaaaggg
cttttcatcaaaggcatctatggccgcgagatgtttgaaacctggtataagatggcggcg
ctgatccagtccggcctcgacctgtcgccgattattactcaccgcttcaccatcgacgac
ttccagaaaggcttcgacgccatgcgttctggtcagtccggtaaggtcattctgagctgg
gattaa

DBGET integrated database retrieval system