KEGG   Cronobacter muytjensii: AFK63_19745Help
Entry
AFK63_19745       CDS       T04067                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00250  Alanine, aspartate and glutamate metabolism
cmw00410  beta-Alanine metabolism
cmw00640  Propanoate metabolism
cmw00650  Butanoate metabolism
cmw01100  Metabolic pathways
cmw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AFK63_19745
   00650 Butanoate metabolism
    AFK63_19745
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFK63_19745
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFK63_19745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmw01007]
    AFK63_19745
Enzymes [BR:cmw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AFK63_19745
Amino acid related enzymes [BR:cmw01007]
 Aminotransferase (transaminase)
  Class III
   AFK63_19745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALB72717
UniProt: A0A0K2PJI7
LinkDB All DBs
Position
4315047..4316312
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRQSATPRGVGVMCGFYAEKAENATLWDVEGNEIIDFAAGIAVLNTGHRHPR
VVEAIENQLRAFTHTAYQIVPYESYVSLAERINGRAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTRRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHAQYPNELHGVSVD
DAMASLERIFKADIAPDQVAAIVLEPVQGEGGFNVAPPAFMQALRALCDEHGILLIADEV
QTGFARTGKLFAMEHYSVKPDLLTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIDEENLCQRANELGQHLKEVLNQARQHCPAIAEVRGQGSMVAVEFND
PQTGKPSPSFTQDVQARAREEGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALAILSRALG
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattcagaattgaaccaacgtcgtcagagcgccaccccacgtggcgtcggcgtc
atgtgcggcttctatgccgaaaaagccgaaaacgccaccctgtgggacgtggaaggcaac
gagattatcgacttcgcggcaggcatcgcggtgctgaacaccggccatcgccacccgcgc
gtcgtggaagccatcgaaaaccagctgcgcgcctttacccatacggcgtaccagattgtg
ccctacgaaagttatgtgtcgctggccgagcgcatcaacggacgcgcgcccattgacggc
ccggcgaaaaccgctttcttcaccaccggcgcggaagccgtcgaaaacgccgtgaaaatt
gcccgcgcgtatacccgtcgtcctggccttatcacctttggcggcggcttccacggacgc
acgtttatgacaatggcgctgaccggcaaagtcgcgccgtacaaaatcggcttcggcccg
ttccctggctccgtgttccacgcgcagtacccgaatgaactgcacggcgtatcggtggac
gacgcgatggcgagccttgagcgcattttcaaagcggatatcgcgccggatcaggtggcg
gccatcgtgctggagccggttcagggcgaaggcggctttaacgtggcgccgcccgcgttt
atgcaggcgctgcgcgcgctttgtgacgagcacgggatcctgctgattgccgatgaggtg
cagaccggtttcgcacgcaccggcaagctgttcgcgatggaacactacagcgtgaagcct
gacctgttgacgatggcgaaaagcctggcgggcggtatgccgctttccggcgtggtgggg
cgagcggaggtgatggacgcgcccgccccgggcggcctcggcggcacctatgcgggcaac
ccgctggcggtcgcggcggcgcatgcggtgctggacgtgattgatgaggaaaatctgtgc
cagcgcgcgaacgagctgggccagcacctgaaagaagtgctgaatcaggcgcgtcagcat
tgcccggccatcgcggaggtgcgcgggcagggctcaatggtggccgtggaattcaacgat
ccgcagaccggcaagccgtcgccgtcgtttacccaggacgtgcaggcgcgcgcccgtgaa
gaggggctgctgctgttgagctgcggcgtttacggcaacgttatccgcttcctgtatccg
ctgactattccggatgcgcagttcagcaaagcgctggcgatcctctcccgcgcgctgggg
cggtaa

DBGET integrated database retrieval system