KEGG   Cronobacter muytjensii: AFK63_19910Help
Entry
AFK63_19910       CDS       T04067                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00564  Glycerophospholipid metabolism
cmw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFK63_19910 (glpD)
Enzymes [BR:cmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AFK63_19910 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ALB72748
LinkDB All DBs
Position
complement(4352389..4353906)
Genome map
AA seq 505 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
TGLRFGSDSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVKKGGEVLTRTRATSARRENG
MWIVEAEDIDTGKTYTWQARGLVNATGPWVKNFFDDGLQLKSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKDVAIDESEISYLLKVYNAHF
KKPLGRDDVVWTYSGVRPLCDDESDSPQAITRDYTLDIHDDNGKAPLLSVFGGKLTTYRK
LAEHAMEKLSPYYHNIGQAWTRNAVLPGGAFQGERDDYAAQLRRRYPFISEALARHYART
YGSNSELILGDAADLNALGENFGHEFYEAELRYLVEHEWVRRLDDAIWRRTKLGMWLNAE
EQSRVAQWLAENVDKKANVTLSLAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtgggggcatcaacggtgccggtatcgcggca
gacgccgcagggcgtggattatctgtgctgatgctggaagcgcaggatctggcatgtgcc
acctcttccgccagctccaaattgatccacggcgggctgcgctacctggaacattatgag
ttccgtctggtgagcgaggcgctggccgagcgcgaagtgctgctgaaaatggcgccgcac
atcgccttcccgatgcgctttcgactgccgcaccgcccgcatctgcgccccgcgtggatg
atccgcaccggcctgtttatgtacgatcacctcggcaaacgcaccagcctgccgggctct
accggtttgcgttttggttcggattccgtcctgaagccggaaatcgtgcgcggtttcgaa
tattctgactgttgggtcgatgacgcccgcctggtgctggcgaacgcccagatggttgtg
aaaaaaggtggtgaagtgctgacccgcacccgcgccacctctgcacgccgcgaaaacggc
atgtggattgtggaagcggaagatatcgacaccggcaaaacttacacctggcaggcgcgc
ggtttggtgaacgccaccggcccgtgggtgaaaaacttcttcgatgacggcctgcaactg
aaatcgccttacggcatccgccttatcaaaggcagccacattgtggtgccgcgcgtgcat
acccagaagcaggcgtacattctgcaaaacgaagataagcgcatcgtatttgtcattccg
tggatggatgagttttctatcatcggcaccacggacgtcgagtacaaaggcgatccgaaa
gacgtggcgatcgacgagtcggaaatcagctacctgctgaaagtctacaacgcgcacttc
aaaaaaccgctgggccgcgacgatgtggtctggacatactccggcgtgcgtccgctttgc
gatgacgaatccgattcgccgcaggcgatcacccgtgactatacgctcgatattcacgac
gacaacggcaaagcgccgctgctgtcggtcttcggcggtaagctcacgacgtaccgcaag
cttgccgaacatgcgatggagaagctgtcaccgtattaccacaatatcggccaggcgtgg
acccgcaatgcggtgctgccgggcggggctttccagggcgaacgcgatgattacgccgcg
cagctgcgccgccgttatccgttcatcagcgaggcgctggcgcgtcactacgcgcggacc
tacggcagcaacagcgagctgattctgggcgatgccgccgatcttaacgcgctcggtgaa
aacttcggccatgagttctacgaagcggaactgcgctacctggttgagcatgagtgggtg
cgccgtctggatgacgccatctggcgccgtaccaaactgggcatgtggctgaacgctgaa
gaacagtcgcgcgtcgcgcagtggctcgccgaaaacgtcgataaaaaagcgaacgtcacg
ctctctctcgcctcgtaa

DBGET integrated database retrieval system