KEGG   Chelonia mydas (green sea turtle): 102929316Help
Entry
102929316         CDS       T02989                                 

Gene name
KMT5A, SETD8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102929316 (KMT5A)
Enzymes [BR:cmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102929316 (KMT5A)
Chromosome and associated proteins [BR:cmy03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102929316 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF2397
Motif
Other DBs
NCBI-GeneID: 102929316
NCBI-ProteinID: XP_007058333
LinkDB All DBs
Position
Un
AA seq 276 aa AA seqDB search
MHHEVKCQGKTLNETCKRGDGKKRTVNTIEGAIKPEDQNDKESGCNSSASLPNQKQEAAE
TQKSMPLPSDSTDAANAKQAQKKVVKAKPGPRRKAQGKTSQNRKVTDYYPVRRSSRKSKT
ELQTEEKRRIDELIESGKEEGMKIDFIDGKGRGVIATKHFSRGEFVVEYHGDLIEIMDAK
KREAVYAQDPSTGCYMYYFQYLSKMYCVDATKETNRLGRLINHSKCGNCQTKLHDVDGVP
HLILIASRDIKVGEELLYDYGDRSKASIEAHPWLKH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatgaggtgaaatgtcaaggcaaaacactaaatgaaacatgcaaaagaggagac
gggaaaaaaaggactgttaatacaatagaaggtgctataaaaccagaagatcagaatgat
aaagaaagtgggtgtaattcttcagcgtctcttcctaatcaaaaacaagaagctgcagaa
acacagaaaagcatgcctctgccttctgattctactgatgcagcaaatgcaaagcaagct
cagaagaaggtggtaaaagcaaaacctggaccaaggagaaaagcgcaaggaaaaacatca
cagaatcgaaaagtgacagactattaccctgttagaagaagttcccggaagagcaaaact
gaattgcagactgaggaaaagaggagaatagatgaattaattgaaagtgggaaagaagaa
ggaatgaagattgatttcattgacggtaaagggagaggggtaattgctaccaaacacttc
agtcgaggagaatttgtggtagaatatcatggggatctcatagagatcatggatgctaaa
aagcgagaagctgtgtatgcccaagatccatccacaggctgctatatgtactactttcag
tatttaagcaaaatgtactgtgtcgatgctacaaaagagactaatcgtctgggaaggctg
attaatcacagcaaatgtggcaattgtcaaacaaagcttcatgatgttgacggcgtacct
catctcatactgatagcctcgcgagacattaaagtgggtgaagaactattgtatgattat
ggagacaggagcaaagcttccattgaagctcatccatggctgaaacactaa

DBGET integrated database retrieval system