KEGG   Chelonia mydas (green sea turtle): 102929376Help
Entry
102929376         CDS       T02989                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00512  Mucin type O-glycan biosynthesis
cmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102929376 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmy01003]
    102929376 (WBSCR17)
Enzymes [BR:cmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102929376 (WBSCR17)
Glycosyltransferases [BR:cmy01003]
 O-Glycan biosynthesis
  Mucin-type
   102929376 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102929376
NCBI-ProteinID: XP_007054221
LinkDB All DBs
Position
Un
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITVKSGDSFHEIHPRAEVANLTAHGISPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYAKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGH
ITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKEVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNMKSRLPQLLD
CEKVKSSLHKRWNFIQNGAILNKGTGRCLEVESKGMSGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgaggcgagtcaaagttctgttggtgttgaacttgattgcagtggctggc
tttgtcctctttctggccaagtgtagacccatcaccgtcaagagcggggattccttccat
gaaattcatcccagggcagaagtggccaacttgacagcccatggcatcagccctatccag
gatgcagtactgaaaaggctctcccttctagaagatatagtctacaggcagctaaatggt
ttgtctaagtcgcttggtctcattgaaggctacggtgggcgtggtaaaggtgggcttcct
gccaccctttccccggcagaggaagagaaagctaaggggccacatgagaaatatggctat
aattcctacctcagtgagaaaatttcactggatcgttccataccggattatcgtccaacc
aagtgcaaagagctgaaatatgcgaaagatctgccccagatttccattattttcatcttt
gtgaatgaagcattgtcagtgatcctgaggtccgtgcacagtgctgttaatcacacgcca
gcccacctcctgaaagagattatacttgtggacgacaacagcgatgaagaggaattgaag
gcacctctggaagagtatgtcaacaaacgatatccggggctcgtgaaggtggtgcgcaac
cagaaaagagaaggcctgatccgagctcgcattgaaggttggaaagctgctactggccac
atcactggattctttgatgcccacgtggaattcactgctggctgggctgagccggttctt
tcacgaatccaagaaaaccggaaaagggttattcttccatccatcgacaatatcaagcag
gacaactttgaggtgcagcgttatgagaactctgcccatggatacagctgggagttatgg
tgcatgtacattagccctcccaaagactggtgggatgctggtgacccttcactgccaatc
aggacacctgctatgattggctgttcgtttgttgtaaacaggaagttctttggagaaata
ggtcttctggatcctggaatggatgtatatggaggagagaacatagagctaggaatcaag
gtgtggctgtgtggtggcagcatggaagtcctgccgtgctccagagtcgctcacattgag
cgcaagaagaagccctacaacaataacattggtttctacaccaagcggaacgctttgcga
gtggccgaagtgtggatggacgattacaagtctcacgtttacattgcgtggaacttgcca
ctggagaatccaggcattgacattggggatgtctcggagagaaaagcattaagaaaaagc
ttaaagtgtaagaatttccagtggtacctggaccatgtttacccagaaatgaggagatac
aataatactattgcctatggggagcttcgtaacaacaaagcgaaagaggtatgccttgac
cagggtccgcaggagaaccacacagcaatactgtatccgtgccacggctggggacctcag
cttgcccgctacaccaaggagggattccttcacttaggggcccttgggaccacgactctc
ttgccagatacccgctgcctggtggataacatgaaaagccggctccctcagctccttgat
tgtgaaaaagtcaagagcagtctccataaacgctggaatttcatacagaatggtgcgatc
ctgaataaggggactgggcgctgcttggaagtggagagcaaaggaatgtccggcattgat
ctaattcttcgcagctgcacgggacaaagatggacaattaaaaacttcatcaagtaa

DBGET integrated database retrieval system