KEGG   Chelonia mydas (green sea turtle): 102932236Help
Entry
102932236         CDS       T02989                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy03410  Base excision repair
Module
cmy_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102932236 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmy03400]
    102932236 (LIG3)
Enzymes [BR:cmy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102932236 (LIG3)
DNA repair and recombination proteins [BR:cmy03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102932236 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 102932236
NCBI-ProteinID: XP_007067197
LinkDB All DBs
Position
Un
AA seq 905 aa AA seqDB search
MAEQRYCVDYAKRGTAGCKKCKEKILKGMVRIGKVVPNPFTESGGEMKEWYHVKCIFEKL
ERARATTKKIEDITDLEGWEQLQDPEKDMINQYISEASSKAANTPKKKATIQAKLSPSGQ
ITSPKKELLATPNPSPKKFSGFTAKPGNSDEAPESSSHKSSLSAKKCDPKHKDCLLREFR
KLCAMVAEKPSYNVKTQIIQDFLQKGTAGDGFHGDLYLTIKLLLPGVIKSVYNLNDKQIV
KLFSRLFNCSQEEKDFKLQQGDVSETVRIFFEDSKSCPPAAKSLLTIQEVDEFLTQLSKL
SKEDDQQSVLQDITSRCTGNDLKCIIRLIKHDLKMNAGAKHVLDALDPNAYEAFKASRNL
QNVVERVLRNQQEADKLPGLKRTLSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEI
KYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDFIPQAFPGGHSMILDAEVLLIDNK
AGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNNTSLMDRPLRERRKFLHDNMVEIPXP
DTLLXDEACHKSFRSGRYDNRVIREGLEGLVLKDIKSTYEPGKRHWLKVKKDYLNEGAMA
DTADLVVLGAFYGQGSKGGMMSIFLMGCYDPKSQKWCTVTKCAGGHDDATLARLQKELDM
VKISKDPSKIPSWLKINKIYYPDFIVPDPKKAPVWEITGAEFSKAEAHTADGISIRFPRC
TRIRDDKDWKTATNLHQLKELYQLSKEKSDFNIVAEEEGSTASSSGENEGNSRSSTPHKI
AKTPPSKSPAKAKKPEGSKAVVRSPAKKAEEKRGEKRKAAEPDDNRKKMLLDIFTGVKLY
LPPSVEDFSKIRRYFVAYDGDLVQEFDTASATHVIGDVDENLGAKRVSPDWIWECIRKRR
LVAPR
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcagaggtactgcgtggactatgccaagcgcggcacagccggctgcaagaaa
tgtaaggagaagatcttgaaggggatggtgcgcattgggaaggtggtccccaaccccttc
acagagtcgggcggggagatgaaggagtggtaccatgtgaagtgcatttttgagaagcta
gagagggctcgggccacaacaaagaagattgaagacatcacagacttggagggttgggaa
cagctccaggatccggagaaagatatgataaaccagtatatctcagaggccagttccaag
gctgcgaacacacctaagaaaaaggcgacaatccaggcgaagctctcccccagcggacag
ataaccagtcccaagaaggagctgctagctacccccaatccatcaccaaagaaattctct
ggcttcacagctaaaccgggcaattctgatgaagcccctgaaagctcttcccacaagtct
agcctctctgcaaagaagtgtgacccaaagcacaaggattgcttgctgcgggagttcaga
aagttgtgcgccatggttgccgagaagcccagctataacgtgaaaacgcaaatcattcag
gacttcttgcaaaaaggaactgcgggagatggcttccatggtgacctctacctgactatt
aagctgctattaccaggtgtcattaaaagtgtttacaacttgaacgacaagcagattgtc
aagctattcagcaggcttttcaactgcagccaggaggagaaggattttaaactgcaacag
ggagatgtttccgaaacggtgcgcatcttttttgaagacagcaagtcctgccctcctgct
gccaaaagtctccttaccatccaggaagtggatgagttcctcactcaactttcaaagctt
tccaaggaggacgaccagcaaagtgtgctgcaggatatcactagcaggtgcacagggaat
gacctgaaatgcatcatcaggctaataaagcatgatctgaaaatgaatgctggtgcaaag
catgtgttggatgctttagatcctaatgcttatgaggcattcaaagcctcccgcaatctc
cagaatgtggtggagcgagtgctgaggaaccagcaggaggctgacaagttgccaggtctg
aagcgaaccctcagcgtccaggcctcactgatgacccctgttcaacccatgctggctgaa
gcctgcaagtcaattgaatacgccatgaagaagtgccccaatgggatgtatgcagagatc
aaatacgatggggagcgagtccaggtccacaagaatggagatcacttcagctacttcagc
cgaagcctcaaacctgtcctccctcacaaagtagcccattttaaggacttcatcccccag
gctttccctggtggacatagtatgatcctggatgcggaagttcttctgattgacaacaaa
gcaggcaaaccactacccttcgggacccttggagtgcataagaaagctgctttccaggat
gccaatgtctgcttgttcgtgtttgactgcatctatttcaataacaccagcctgatggac
aggcccctgcgtgagcgtcgaaagtttctccatgataacatggtggaaatccccnaaccg
gatactcttctctgagatgaagcatgtcacaaaagcttcagatctggcagatatgataat
cgagtcatccgtgaggggctggaaggactggtgctgaaagatataaagagtacgtacgag
cctggtaaacgtcactggctaaaagtgaaaaaggactatctgaatgaaggtgccatggct
gacacagcagacttggtggttctgggagctttctatggacaaggcagtaaaggtgggatg
atgtccattttcctcatgggctgctatgaccccaagagccagaaatggtgcacggtgaca
aagtgcgcgggtgggcacgatgatgccaccctggctcgcctgcagaaggagctggacatg
gtgaagatcagcaaggatcccagtaaaattccaagctggctgaaaattaacaagatctat
tatccagacttcattgttccagacccaaagaaagccccggtgtgggagatcacaggtgct
gagttctctaaagcagaagcccacactgcagatgggatctccatccgcttccctcgctgc
acccggatccgagatgacaaagactggaagacggccaccaacctccatcagctcaaggag
ctataccagctctccaaggagaagtccgatttcaatatcgtagcagaggaggaggggtcc
acagccagcagcagtggcgagaatgagggaaattctaggtcttccacaccccacaaaatt
gctaagacacccccaagcaagtcacctgcaaaagccaagaagccagaaggcagcaaagca
gttgttagatctccggcaaagaaggcggaggaaaagcgaggggagaaacggaaagcagct
gagccggacgacaacagaaagaagatgctgctggacatatttacaggggtgaagctgtac
ctaccgccctccgtggaggacttcagcaaaatccgccggtactttgtggcgtatgatgga
gaccttgtgcaagagttcgacactgcctcagcaacacatgtaataggggatgttgatgag
aaccttggagccaagcgcgtctctcctgactggatctgggagtgtatccggaaacggagg
ctagtggccccccgttaa

DBGET integrated database retrieval system