KEGG   Chelonia mydas (green sea turtle): 102932280Help
Entry
102932280         CDS       T02989                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00250  Alanine, aspartate and glutamate metabolism
cmy00410  beta-Alanine metabolism
cmy00430  Taurine and hypotaurine metabolism
cmy00650  Butanoate metabolism
cmy01100  Metabolic pathways
Module
cmy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102932280 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102932280 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102932280 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102932280 (GAD1)
Enzymes [BR:cmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102932280 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102932280
NCBI-ProteinID: XP_007056648
LinkDB All DBs
Position
Un
AA seq 590 aa AA seqDB search
MASSAPSSSNANQDSNPTNLRPTTYDTWCDVAHGCTRKIGLKICGFLQRNNSLEDKGRIV
SSLKERQSSKNLLACENSEREARFRRAETDFSNLFARDLLPAKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDVIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYGIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TENVILIKCNERGKIIPADLEAKILEAKQKGHVPLYVNATAGTTVYGAFDPIEEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILIREKGLL
QGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELSEYLYTKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSEERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVVSNPAATKSDIDFLIEEIERLGQDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctgctccatcctcctccaacgccaatcaggactccaaccccactaattta
cgacccacaacctacgacacctggtgtgatgtggctcatggatgtaccagaaaaattggt
ctcaaaatatgtgggttcttgcaaaggaacaacagcctggaagataagggccggattgtg
agctctctcaaggaaaggcagtcttccaagaacctgctggcttgtgagaacagcgagagg
gaagccaggttcaggagggccgagacagacttctccaatttatttgctagagatttgctg
cctgccaagaatggcgaggagcagaccatgcagttcctgctggaggtggttgacattctc
ctgaactacgtgaggaagacgttcgacaggtccaccaaagtcctggacttccatcacccg
caccagctgctggaagggatggagggcttcaacctggagctctcggacaaccccgaatcc
ctggagcagatcctggtggactgcagggacacgctgaagtacggagtcaggacaggtcat
cctcgttttttcaaccagctctccactggactggatgttattggcttggctggtgaatgg
ctgacctcaactgcaaatactaacatgtttacatatgaaattgcacctgtttttgtcctc
atggagcaaataacgcttcgaaagatgagagagattattggatggtcaaataaagatgga
gatggaatattctcacctggaggggctatatccaatatgtacggcataatggctgctcgc
tacaagtatttccctgaagtcaaaactaaaggcatggctgcagttcctaaactggttctc
ttcacttcggaacatagtcactactcaataaagaaagctggggctgcacttgggtttgga
acagaaaatgtgattttgataaaatgcaatgaaagagggaaaataataccagctgatttg
gaagctaaaattctggaagctaagcaaaagggacatgttccactttatgtaaatgcaacc
gcaggcacaacagtgtacggggcctttgatccaatagaggagattgcagacatatgtgaa
aaatataacctctggctccatgtagatgctgcttggggaggtggactgctaatgtccagg
aagcatcgtcataaactgaatggaatagaaagagccaattcggtcacatggaatccacac
aagatgatgggagttttgttacaatgttcagccattctgattcgggaaaagggtctactt
cagggttgcaatcagatgtgtgccggatatctgttccagcaagataaacaatatgatata
tcctatgacactggagataaagcaatacaatgtggtcgtcatgtggacattttcaaattc
tggctgatgtggaaagctaagggtacagtaggatttgaaaatcagatcaacaaatgtctg
gaattgtcagaatacctctatactaaaattaaaaacagggaagaatttgagatggttttt
gatggagagcctgaacacacaaatgtatgtttctggtacattcctcagagtctcaggggc
ataccagactctgaggagagaagagaaaagctacacagggtggcacccaaaatcaaagct
ctgatgatggagtcaggtaccacaatggttggatatcagccacagggagataaagtcaac
ttcttccgaatggttgtctcaaacccagcggcaactaagtctgacattgacttcctcatt
gaagaaatagaaagattggggcaggatctgtaa

DBGET integrated database retrieval system