KEGG   Chelonia mydas (green sea turtle): 102932759Help
Entry
102932759         CDS       T02989                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00010  Glycolysis / Gluconeogenesis
cmy00052  Galactose metabolism
cmy00500  Starch and sucrose metabolism
cmy00520  Amino sugar and nucleotide sugar metabolism
cmy00524  Neomycin, kanamycin and gentamicin biosynthesis
cmy01100  Metabolic pathways
cmy01200  Carbon metabolism
cmy04910  Insulin signaling pathway
Module
cmy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cmy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102932759 (GCK)
   00052 Galactose metabolism
    102932759 (GCK)
   00500 Starch and sucrose metabolism
    102932759 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    102932759 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102932759 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102932759 (GCK)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     102932759 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102932759
NCBI-ProteinID: XP_007067529
LinkDB All DBs
Position
Un
AA seq 386 aa AA seqDB search
MKPSQEDTLHLVEQILSEFRLQEEDLKKVMRRMQKEMDRGLKLDTHEEASVKMLPTYVRS
TPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVTTKHQMYSIPEDAMTGTAEMSMS
SPSSEIFKFKRCGLVVIDQRKASECDPGTGCNACYMEEMENVELVEGDEGRMCVNTEWGA
FGASGELDEFLLEYDRVVDETSLNPGHQLYEKMIGGKYIGEIVRLVLLKLVNENLLFHGE
ASEKLKTRGSFETRFVSQIESDADDRKQTYNILTSFELLPSLTDCDIVRMACESVSTRAA
QMCSAGLAGVINRMRESRSEERLKITVGVDGSVYKLHPSFKDQFHATVRQLTPGCDITFL
QSEEASGRGAALISAVACKMACLIGQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaagccaggaggacaccttgcacctggtggagcagatcctgtctgagttccgg
ctgcaagaggaggatctgaagaaggtgatgcgtcggatgcagaaggaaatggatcggggg
ttgaagctggatacacatgaggaagcctctgtgaaaatgctgcccacttacgtgcgctcc
acacccgaaggctcagaggtcggggacttcctgtcgttggatctcggcggcaccaacttc
cgtgtgatgctggtgaaagtgggtgaaggggaagaagggcagtggagcgtgacgacaaag
catcagatgtattccatcccagaggacgccatgacaggaaccgccgaaatgtcaatgagt
tcaccctcgtccgagatatttaaattcaagcggtgtggcttagttgtgatagatcagaga
aaagcatcagagtgtgacccgggtaccggctgcaacgcttgctacatggaggagatggag
aatgtggagctggtggagggggacgagggccggatgtgcgtgaacaccgagtggggggcc
ttcggcgcctcaggggagctggacgagttcctcctggagtacgatcgcgtggtggacgag
acctcacttaaccccgggcaccagctctacgagaagatgatcggagggaagtacatagga
gagatcgtgcggctggtgctgctaaaactggtcaatgaaaatctgctcttccacggggag
gcgtccgagaaactgaaaaccagaggcagtttcgaaacccgcttcgtctcacagattgaa
agcgacgccgatgaccggaaacagacctacaacatcctgacgtccttcgagctgctgccc
tcgctcacggactgcgacatcgtgcggatggcgtgcgagagcgtctccacgcgggcggcg
cagatgtgctcggcggggctggccggggtgatcaaccgcatgcgggaaagcaggagcgag
gagcggctgaagatcaccgtgggagtcgatggctcggtctacaagctccaccccagcttc
aaagaccagttccacgcgacggtcagacagctgacgcctggctgcgacatcaccttcctc
cagtcggaggaggccagcggcaggggggccgccctgatctcggcggtagcgtgcaaaatg
gcctgcctgattggccagtga

DBGET integrated database retrieval system