KEGG   Chelonia mydas (green sea turtle): 102932898Help
Entry
102932898         CDS       T02989                                 

Gene name
ERCC5
Definition
(RefSeq) ERCC excision repair 5, endonuclease
  KO
K10846  DNA excision repair protein ERCC-5
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    102932898 (ERCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmy03400]
    102932898 (ERCC5)
DNA repair and recombination proteins [BR:cmy03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     102932898 (ERCC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 102932898
NCBI-ProteinID: XP_007066305
LinkDB All DBs
Position
Un
AA seq 1143 aa AA seqDB search
MGVQGLWKLLECSGRPINPETLEGKILAVDISIWLNQAVKGARDRHGNTIQNAHLLTLFH
RLCKLLFFRIRPVFVFDGEAPLLKRQTLAKRRQRKELAASDSKKTTEKLLKTFLKRQAIK
TALTGKSNEALPSISQVRREEIDDMYVLSSLQEEEKKSSEDEDEKEWEERMSQKKILQEE
FFDNPHSVDIESEDFSSLPPEVKHEILTDIKEFTKRRTLFEAMPEESNDFSQYQLKGLLK
KNNLNRYIENVEKEMSQQDSGQIQTQYENEGGFMKEVESKRVVSEDTSHYILIKGIQVKE
ATSTHLETLSVGHSTGPEYNIPDKIHNEMNANTKPPSPEKLKTEKASNVAGAPPSPRTLL
AIQAAMLESSSEEEPEDEDKRKLNLDQATLCPSTVEGNVSPRTLQVIQQALSGGDDDVRA
VITASADRTQMEMSGVKDLISSSDEVSKIKDGKESLLLPTDLSTNTVLMQDDESDQKCTS
DFFLIPVSKGVCTPCVKNDSSVEIISIDKEQPEDEQEYTSKMDSRSLQESMDISMQKPIS
STTKTTSVAMIHSETTEISNNVEYENVECVFPEAEKNAPELQHPLSVTPEIANPNEARVQ
RKSHSEESDSDGSFIEVDSEISNDTEFPGEIFKTSHAPSEPNETLAVEAAATELEKEEDD
GATENLLKDAAEEVQLTIHQNAETKKDREGAVNEWQDISLKELEALENNLSVEQNMLQAQ
KQQQERIAATVTGQMFLESQELLRLFGVPYIEAPMEAEAQCAVLDLTDQTSGTITDDSDI
WLFGARHVYKNFFNQNKYVEYYQYVDIQNQLGLDRSKLINLAYLLGSDYTEGIPSVGYVT
AMEILNEFPGHGMEPLLKFTEWWTEAQKNKKIRPNPHDTKVKKKLQQLQLSPGFPNPAVV
KAYLKPVVDESKGSFIWGRPDVEQIREFCQSCFGWTRTKTDEALLPVLKQLNSQQTQLRI
DSFFRLAQHEKQAIKSQRLRRAVTCMRRKEKEAVADEIQEATAVVEREFKHGEERKGKIA
VQGTTDLSTAAQSQRIKRKKHSKSKEESFHGGGFIGEVQLSEGSSGSSGEDSESEVLNKS
KRGKTVKESAIQKNTVRQEEDVTSSSSGEGEDEENTVMVTARSVFEGKKGKSWNMRGRKK
KKC
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcaaggactttggaaactgcttgaatgctctggaagacctataaacccagaa
actttggaaggaaaaattcttgctgttgatattagcatttggttgaatcaagcagtaaaa
ggagcaagggaccgtcatggtaacaccatacaaaatgctcacctactcactttgttccat
cgactctgcaagttgttattttttcgaatccggcctgtctttgtttttgatggggaggca
ccgctactgaagaggcaaactttggctaaacgaagacaaagaaaagaattggcagccagt
gactctaagaaaactaccgaaaaactcttgaaaactttcctgaaaagacaagctatcaaa
acggctttaacaggcaaaagcaatgaagcactgcccagtatttcacaagttcgaagagaa
gaaattgatgatatgtatgtattgtcttctttacaagaggaagaaaaaaagagttcagaa
gacgaagatgaaaaagagtgggaagagagaatgagccaaaaaaaaatattgcaggaagaa
ttctttgacaatcctcattctgtagacattgaatcagaagacttcagcagtctgcctcca
gaagtgaaacatgaaatcctaacagacataaaggagtttacaaagcgacgaacattattt
gaggccatgccagaggagtccaatgacttctcacaatatcaactcaagggtttgcttaaa
aaaaacaacctcaatcgatacatagaaaatgtggaaaaagagatgagtcagcaggactca
ggccaaatccaaacccaatatgaaaatgaggggggcttcatgaaagaagtggaaagcaag
agggtagtctctgaagatacttctcactacattctgataaaaggtattcaagtaaaggaa
gccaccagtacgcacttagaaactctttcagttgggcattccacaggacctgaatataac
atacctgataaaatacataatgaaatgaatgctaataccaagccaccttcacctgaaaag
ttaaagacagagaaggctagcaatgtagctggagcaccaccttctcccagaactttgctt
gctatacaggcagctatgttagaaagcagctcagaagaggagccagaggatgaagataaa
aggaagctgaatttggaccaagccactctctgtcccagtacagttgaaggcaatgtatca
ccaagaacactacaggttattcagcaagctttaagtggtggtgatgatgatgtgagagca
gttattaccgctagtgctgatagaacacaaatggaaatgtcaggggtgaaggatcttatt
agtagctcagatgaggtttctaaaattaaggatggaaaagagtcgctacttttacctaca
gatctttcaacaaacaccgtccttatgcaagatgatgaatcagaccagaaatgtacgtca
gatttttttttaatccctgtatctaaaggtgtgtgcacaccttgtgttaaaaatgattcc
tctgttgaaatcattagtatagataaagaacagccagaagacgaacaagagtacacttca
aaaatggactcaagatctctgcaagaaagtatggatatttccatgcagaaaccaataagt
tccacaacaaagaccacttcagtagctatgattcattcagaaactacagaaatttccaac
aatgtggaatatgaaaatgtagagtgtgtttttccagaagcagaaaagaatgctcctgag
ctacagcatccactttcagtcactccagaaatagcaaatcctaatgaggcaagagtacaa
aggaaatcacattctgaagagagtgattcagatggtagctttattgaagtcgacagtgaa
attagtaatgacactgagtttccaggtgaaatatttaaaacatcacatgctccctctgaa
cctaatgagacattggctgttgaagcagcagctacagaactggagaaggaagaagatgat
ggggccacagagaacctccttaaagacgctgctgaagaagtgcagctgactattcatcag
aatgctgaaaccaaaaaagacagggaaggtgcagtgaatgagtggcaagatattagtttg
aaggaattggaagctctggagaacaacctttctgttgagcaaaacatgcttcaggctcaa
aaacaacagcaggaacgtattgctgccactgtaacaggacagatgttcttggaaagtcag
gaacttctccgtctgtttggtgttccttacattgaagcacccatggaggcagaggctcag
tgtgctgtcttggaccttactgatcagacctctgggacaatcactgatgatagtgatatt
tggctgtttggagcgcggcatgtttataaaaatttcttcaatcaaaacaagtatgtggaa
tattaccaatatgtggatattcaaaaccaactagggttagacagaagcaagttaattaat
ttggcctatttgcttggaagtgattacactgaaggaatcccatctgttggctatgtaaca
gcaatggagattttaaatgaattccctgggcatggaatggaacctctcttaaaattcact
gaatggtggactgaagctcagaagaataagaaaataagacccaatccgcatgatactaaa
gtaaagaaaaaactgcagcaactgcagctgagtcctggcttcccaaatcctgcagtagta
aaagcttacctgaaacctgtggtggatgagtcaaaggggtcattcatctggggaaggcct
gatgtagaacagatcagagaattctgtcagagttgctttggctggactaggacaaagaca
gatgaagcccttttgcctgtacttaaacagctgaactcacaacagactcaacttcgaatt
gattcattcttcagactagcacaacatgagaagcaagccattaagagccagagacttcga
agagctgtgacttgtatgcggaggaaagaaaaagaagcagtagctgatgaaattcaggag
gctactgctgttgtagaaagagaatttaaacacggtgaggaaaggaaaggaaaaatagct
gtccaaggtacaacggatctatctactgcagcacaaagccaaaggataaaaaggaaaaaa
cattcaaagtccaaagaggagagtttccatggaggcggtttcattggtgaggtgcagctg
tcagaaggatccagtgggtcttcaggggaggattctgaaagtgaagttttaaataagagc
aaaagaggaaaaactgtcaaggaatcagcaattcagaaaaacacagtgagacaggaggaa
gacgtgactagtagctcaagtggtgagggtgaagatgaagaaaacacagtcatggtgact
gcccgatctgtgtttgagggcaaaaagggaaaatcatggaatatgagaggaagaaaaaag
aaaaagtgctaa

DBGET integrated database retrieval system