KEGG   Chelonia mydas (green sea turtle): 102933153Help
Entry
102933153         CDS       T02989                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00040  Pentose and glucuronate interconversions
cmy00051  Fructose and mannose metabolism
cmy01100  Metabolic pathways
Module
cmy_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102933153 (SORD)
   00051 Fructose and mannose metabolism
    102933153 (SORD)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102933153 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 Methyltransf_25 Methyltransf_16 Pyr_redox_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 102933153
NCBI-ProteinID: XP_007071610
LinkDB All DBs
Position
Un
AA seq 342 aa AA seqDB search
MSFLDHGENRPVPEPGPNEVLLRMHSVGICGSDVHYWQNGRIGDFILKKPMVLGHEASGT
IIKVGSSVTHLKPGDRVAIEPGAPRDIDEFCKIGRYNLSPTIFFCATPPDDGNLCRYYAH
NASFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGSKVLICGAGPIGLVCLLVAKMM
GAAQVVITDLSASRLEKAKEIGADFTIQMKKETPKDMACMVQDLLNCMPDITVECSGAEA
SIQTGIYATRSGGTLVLVGLGPEMVHVPIVNAAVREVDIKGIFRYCNTWPMAISMLASKR
VDIKPLVTHRFPLEKALEAFETTKKGLGVKVMLKCDPSDQNP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttttttggatcatggggaaaatcgcccggtcccagaaccaggtcccaatgaggtg
ctgctgaggatgcattcagtcgggatctgtggatctgatgtccactactggcagaacggt
agaattggggactttattttaaagaagcccatggtgctagggcatgaggcatcgggaacc
atcatcaaagtggggtcatcagtaacccatctgaagccaggcgatcgagtggccattgag
cctggtgctccgcgagacatcgatgaattctgcaaaatcggacgctacaacctgtctccg
actatcttcttctgtgcgacgcctcccgatgatggaaacctgtgccgatattatgcacac
aatgccagcttttgctacaagcttccagataacgtcacctttgaagaaggggccctcatt
gaacctctttctgtgggaatccatgcctgccgaagaggcggagtcactctgggatccaaa
gtcttaatctgtggggctggacccattgggcttgtttgcttgctggttgccaagatgatg
ggtgccgcccaggtagtaatcactgatttatctgcctcccgcctggaaaaagccaaagag
attggggcagatttcaccattcagatgaagaaagagaccccaaaggacatggcctgcatg
gtgcaagatttgcttaactgcatgcctgacataaccgtggagtgctccggggcagaggcc
agcatccaaactggcatttacgccactcgctcgggcgggaccctagttctggtggggctg
gggccagagatggtccacgtccccatcgtgaatgctgctgtgcgggaggtggatatcaag
gggatatttcgctattgcaatacgtggcccatggcgatttctatgcttgcatccaagaga
gtggacatcaagcctttggttacacaccgcttccctttggaaaaagcgctggaggccttt
gagacaaccaagaagggcttgggggtgaaagttatgctgaagtgtgaccccagtgaccag
aatccctga

DBGET integrated database retrieval system