KEGG   Chelonia mydas (green sea turtle): 102933916Help
Entry
102933916         CDS       T02989                                 

Definition
(RefSeq) myeloperoxidase-like
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00983  Drug metabolism - other enzymes
cmy04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102933916
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102933916
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmy04147]
    102933916
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     102933916
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102933916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase SH3_2 SH3_9 SH3_1 RVT_1 DUF3371
Motif
Other DBs
NCBI-GeneID: 102933916
NCBI-ProteinID: XP_007071229
LinkDB All DBs
Position
Un
AA seq 1127 aa AA seqDB search
MSPNPDAAEEELPFKEGQILKVCGDKDADGFYRGECAGRAGYIPCNMVSEVQVESEEERK
EMLKQAELEKQENYKPHPGSSWQDLRADLITPRTMVAAFDYNPRESSPNVDVEAELTFTA
GDVITVFGSMDDDGFYYGELNRQRGLVPSNFLEAVSLDGGMTEGLHLEDKDTCAASAESQ
LNSDGPGEQRDPLPNIPEVPPSCTLICDPSPDQESLETLESSDLSTQSRKKRSFFCKGKK
LLKKLGPSISGMLSAPSLLSSVDEAKQLVDAAYKYTRNRCLEASSSTSLGLRGMLQAQGF
KAYAMCRKSMPNSDSHDSCLRCLGASHQAERCKICKAFKLHTKKERDFRLKQLLMEAALQ
PPASDRAALAPASSVQSALASVCDPAPPRHRKSPALRWDDQLLHWSTSPAPTKQHKQGER
GRSPKELLNRSKMLLTLKDALRARAKNQYHRLLLLLIPHYHSITGSGDWYAALYMKDAYF
HIAIHPAHRRFLWFAINQHHYQFTVLPFGLSTAPRVFMKCKAVVAAFLRKRQVQVYPLKE
KLRNEAFTPADILGHIKQPVGGTRVMIRAADYMETTLSLLKEKLQWTVKGKFNVTDMLTP
AQLELISKATGCAQLNMNIPCDEANPYRTITGECNNRRSPTLGASNRAYSRWLPQEYEDG
VSIPRGWTEGICYSGFPLPLVREVSNKIVRFPTEQLVPDQNRALIFMQWGQFIDHDMDFG
PATPATVTFGSREDCQTSCAKKPPCFPIKIPPNDPRIKNQSDCIPFTRSAPACTMGRAIR
NQINALTAFLDGSMVYGSEVPLANRLRNNTNQLGLMAVNQQFTDGGLEFLPFSNVEKDIC
VLTNKTAQIRCFVAGDTRANEMPELTSLHTLFLREHNRLARELRRLNPHWDGEKLYQEAR
KIIGAMIQIITFRDYLPLLLGNNFRTAIPFYRGYNDSVDPRISSIFTIAFRFAHASIQPF
VFRLDDHYQPVGPPTLLSKEFFATWKIVTQGGIDPILRGLMANQAKLMTQRQMVVDEVRD
RLFEQVMRTGLDLAALNMQRGRDKGLPGYNAWRQFCGLSQPRNLAELSEVLRNCELAKKF
MDLYKTPDNIDIWIGALAEPFVPNGRVGPTMACIIGSQFRKLRDGDR
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctaaccctgatgcagctgaagaagagctcccatttaaggaggggcagattctg
aaggtgtgtggcgacaaagacgctgatgggttttacagaggtgaatgtgcaggaagggca
gggtacatcccttgtaacatggtgtctgaagttcaggtggagagtgaggaagagaggaag
gagatgttaaagcaagcggagctggagaaacaggaaaactacaagcctcatccagggtcc
agctggcaggacctcagggctgacctgatcacacctaggaccatggtggctgcttttgac
tacaaccctagggagagctctccaaatgtagatgtggaggctgagctgacatttactgct
ggagatgttatcacagtgtttgggtccatggatgatgatggattctattacggggagtta
aacagacagagaggccttgtcccgtctaacttcctggaagctgtctctctggatggagga
atgactgaggggcttcatttggaagacaaagacacatgtgcagcgagtgccgagagtcag
ctgaattcagatgggcctggtgaacagagggaccccttgcctaacattcctgaagtgcca
ccttcctgcactctcatttgtgacccaagtccagaccaagaatcactggagactcttgaa
tcaagtgacctgtccactcagagtagaaagaagagaagcttcttctgcaaggggaaaaag
ctcttaaagaaactaggacccagtatctcagggatgctgtcggctccgtcccttctgagc
agtgttgatgaagccaagcagctggtggatgcagcatataagtacacccggaaccggtgt
ctggaagctagttccagcaccagccttgggctgcggggcatgctgcaagcccagggtttc
aaagcttatgccatgtgccgcaagtctatgcctaacagcgactcccacgactcctgtctc
cggtgtctgggagcgtctcatcaggcagagcgctgcaaaatctgcaaggcctttaagctg
cacaccaagaaagaaagagactttcgccttaagcagttgctcatggaggctgcgttacaa
ccaccggcctctgaccgagcggcactggccccagcttcctcggtgcaaagtgccctggca
tccgtgtgcgacccggcaccacccaggcaccgtaaatcaccagcactgagatgggacgac
caacttctgcactggtctacctctccggcaccaactaagcagcacaagcaaggggaaaga
gggcgctctcccaaagaactactaaaccgctcaaagatgctcctgacactcaaagacgca
ttgcgagcccgagccaagaaccagtaccatcgactcctcctcctgttgattccgcactat
cattctatcactggatccggggattggtacgctgccctctacatgaaagacgcatacttc
catattgctattcatccggcgcaccgacgcttcctctggtttgccataaaccaacatcac
taccagttcacggttctcccattcggcctgtccacagccccccgagtgttcatgaaatgc
aaggcggtggtggcagccttcctgcggaagaggcaggttcaagtgtaccctttaaaggag
aaactgaggaacgaagccttcacccctgcagatatcctgggacatatcaagcagccagtg
ggaggaaccagggtcatgatccgagctgctgattacatggaaaccaccctgagcctgctg
aaggagaagttgcagtggactgtgaaggggaagtttaatgtcacagacatgctgacccca
gctcagctggaactgatttccaaggctactggatgtgcccaactaaatatgaatatacca
tgtgacgaagcaaacccttaccgaacaatcactggtgaatgcaacaacaggagaagccct
accttaggggcttcaaacagagcctatagccgatggctgcctcaagagtatgaagatggt
gtttcaatccctcgtggctggacagaaggaatctgttattctggatttcctctcccattg
gtgcgagaagtttcaaacaagattgtacgctttcccactgagcagctcgtaccggatcag
aacagggcgctcatcttcatgcagtggggccagtttattgaccatgacatggactttggc
cctgcgactccagcaacagtcactttcggcagcagagaggactgtcagaccagctgtgcc
aaaaaaccaccttgcttccccatcaagattccacccaacgatccacgaattaaaaaccaa
agtgactgcattccattcacccgctcagcccctgcatgcaccatgggcagagccattcga
aaccagatcaatgcactcacagccttccttgatggcagcatggtgtacggcagtgaagta
cctttggctaacagactaaggaataataccaaccagctgggcttgatggctgttaaccag
caatttactgatgggggattggaattcctgccattcagtaatgtggagaaagacatctgt
gttctcaccaacaaaacagctcaaatccgatgttttgttgcaggtgacactcgagccaat
gaaatgccagagctgacatctttgcacacactttttctccgggagcacaatcgcttggcc
agagagctgaggagattaaatccacactgggatggagagaagctctaccaggaggcccgg
aagatcataggtgccatgatccagattataaccttcagagactacttgcccctcctgctg
ggaaataacttcaggacagcgattcctttctaccgggggtacaatgactctgtggatccc
cgaatatccagcatcttcaccattgctttccgctttgctcacgcttcgattcagcccttt
gtgttccgcttggatgatcattaccagcctgtaggccccccaaccctcctcagcaaagaa
ttctttgctacatggaaaattgtgacacaaggtggcattgaccctattctccgtggcttg
atggctaatcaggccaaactgatgacacagaggcaaatggttgtggatgaagtccgggat
cggctgtttgaacaggtcatgaggactggactggatttagcggcacttaacatgcagcgg
ggcagagataaaggtctcccagggtataacgcctggaggcaattctgtgggctttcacag
cctcgcaacttagctgaactctctgaagtgctgagaaattgtgagctagccaagaagttc
atggacctgtacaagacaccagacaatatcgacatctggattggggcactcgcggagcca
tttgttcccaatggcagagttgggcccaccatggcttgcatcattggatctcagttcaga
aaattgcgagatggggacaggtaa

DBGET integrated database retrieval system