KEGG   Chelonia mydas (green sea turtle): 102933955Help
Entry
102933955         CDS       T02989                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmy01002]
    102933955 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmy04147]
    102933955 (ACE)
   04090 CD molecules [BR:cmy04090]
    102933955 (ACE)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102933955 (ACE)
Peptidases [BR:cmy01002]
 Metallo Peptidases
  Family M2
   102933955 (ACE)
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102933955 (ACE)
CD molecules [BR:cmy04090]
 Proteins
  102933955 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 102933955
NCBI-ProteinID: XP_007062053
LinkDB All DBs
Position
Un
AA seq 1269 aa AA seqDB search
MSQGVEEAPSFKINNYELEVVNEFIFLGSTLAVNLSLEKELNIRIGKAATTLSRQNKRVW
KRGSTAFICVAFVESLESPGGTVTNTEVLKRASIPSMQTLLQQRRPRWLGHVCCRDDGHI
PKFILRGELAFGKRPKGRPTLRFKDVCKRDLKEMDMDVDNWEDRPQDRSLWKQELNEGLQ
SSTRKASSLAEEKRARRRQSPKGGNITFKGDRCGSEYLSQILASLEEQNFTEAWGKKAKE
LYGSIWKNFSDTQLKSIIGSIQTLGPSNLPLDKRQQYNTILSEMDNIYSTAKVCPPNQTT
NCWALEPEITNTMANSRSYKELLYAWEGWHSSAGNPLRPKYEEFVTLSNEAYRMDGFKDT
GAYWRSWYDSPTFEDDLEELYHQLEPLYLNLHAFVRRKLYEHYGSKYINLQGPIPAHLLG
NMWAQQWNNIYDMMVPFPGKPNLDVTSAMVEQNWNATHMFRVSEEFFTSLGLLGMPPEFW
EKSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKD
QPVTFRSGANPGFHEAIGDVMSLSVSTPGHLQKLGLLSQVTQDAESDINYLLKMALEKIA
FLPFGYLIDQWRWNVFSGRTPPSRYNYDWWYLRTKYQGICPPIARNETNFDPGAKYHIPG
NTPYIRYFVSFILQFQFHKALCQAANHTGPLHTCDIYTSKEAGAKLGEVLKAGSSKPWQE
ILFNLTGKEKMDAGALLEYFSPVTTWLQNQNNERNETLGWPDFEWRPPVPEGYPDGIDKV
ADEAQAKDFLVEYNSTAEVVWNAYSEASWAYNTNITDYNKQVMLEKNLEMSAHTLKHGMQ
ARQFDYSDFQDQSVKRILKKLSDIERAALPDLELKEYNNILSDMETTYSIAKVCKGQDKC
YPLDPDLTDILAKSRDYDELLFSWKGWRDASGKEIKSKYKRYVELSNKAARLNGHEDNGA
FWRSLYETATFEADLEQLYQQLQPLYLNLHAYVRRALYNKYGQEHINLKGPIPAHLLGNM
WAQSWSNIFDLVMPYPSATKVDATPAMQKQGWTPERMFQESDKFFTSLGLIPMPPEFWAK
SMIEKPAGREVVCHASAWDFYNRKDFRLKYQGLCPPVPRSEDDFDPGAKFHIPANVPYVR
YFVSFVIQFQFHQALCKAAPAMSADALMTYFKPLTDWLIQENTKNGETLGWPEYNWTPYA
GTSSGGCQAQSSARVSFLGMSLDRNQAAAGQWVLLVLGLLLLIATVVLGVKFCSSRRRAQ
KSSSEMELK
NT seq 3810 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaggagttgaggaagcaccgtccttcaagatcaacaactatgaacttgaagtg
gtgaatgagttcatattcctgggatccactctcgcggtcaacctctcacttgaaaaggaa
ctcaacatccgcattggaaaagctgccacaacactgtctaggcagaacaagagggtctgg
aaaagaggctcaacagctttcatatgcgttgccttcgtcgaatctctggaatctcccgga
gggacagtcaccaacactgaggtgctcaaacgggccagcatacccagcatgcaaacgctc
ctccaacagagacgcccccgctggcttgggcatgtgtgctgcagagatgatgggcacatc
ccaaagttcatcctccgcggtgaactggcatttggaaaaagacccaaaggacgcccaaca
ttgcgtttcaaggatgtgtgcaagcgagacctcaaagaaatggacatggatgtggacaac
tgggaagatcgccctcaagaccgcagcctttggaaacaagagcttaacgaaggtctccag
agttccacgaggaaggcgtccagtttagcagaggagaaaagagctcgcagaagacagagc
ccaaagggtggaaacatcacctttaaaggtgacagatgcggcagcgaatatctctctcaa
atcttggcctccctggaggagcagaacttcacagaggcctgggggaagaaagccaaggaa
ctctatggctccatctggaagaatttctcagacactcagctgaagagtatcattggctcc
atccagaccctggggccttccaacctgcccctggacaagcgtcagcagtacaacaccatc
ctgagcgagatggacaatatctattccactgccaaggtgtgtcctccaaaccagaccacc
aactgctgggctttggagccagagataaccaacaccatggccaactcccgcagctacaag
gagctgctctatgcctgggagggctggcacagctcagctggaaaccccctgaggcccaag
tacgaggagtttgtgacgctgagcaacgaggcctacaggatggacggtttcaaggatacc
ggcgcttactggcgctcctggtacgactcgcccacttttgaggacgatctggaggaactc
taccaccagctggagcccctctacctgaacctccacgcctttgtcaggaggaagctgtac
gaacactacggctccaagtacatcaacctccagggccccatccctgctcatttactgggc
aacatgtgggcccagcagtggaacaatatctacgatatgatggtccccttcccgggcaaa
cccaacctggacgtcaccagcgccatggtggagcaaaactggaacgctacgcacatgttc
cgggtctctgaggagttcttcacctcgctggggctgctggggatgccgccggagttctgg
gagaagtccatgctggagaagccggcggacgggcgggaggtggtgtgccacgcctccgcc
tgggacttctacaaccgcaaggacttcagaatcaagcagtgcaccacggtcaccatggag
cagctcttcacggtgcaccacgagatgggacacgtcgagtactacctgcagtacaaggac
cagccggtcaccttccgcagcggggccaaccctggcttccacgaggccatcggtgacgtc
atgagcctctcggtctccacccccgggcatctccagaagctcgggctcctcagccaagtc
acccaggatgcagagagtgacatcaactacttgctgaaaatggccttggagaagattgcc
tttctccccttcggttacctcatcgaccagtggcgctggaatgtcttcagtggccgcacc
ccccctagccgctacaactatgactggtggtatctgagaactaaatatcagggcatctgt
cctcccattgcaaggaacgaaaccaacttcgaccctggtgcaaagtatcacatccctggc
aacaccccctacatcaggtattttgtgagctttatcctgcaattccagtttcacaaggcc
ctgtgccaagctgccaatcacaccggccccttgcacacctgtgacatctacacatctaaa
gaagcaggagcgaaactcggtgaggtgttgaaagctggctcttccaagccctggcaagag
atcctcttcaatctaactggcaaggagaagatggacgctggggccctcctggagtacttc
agccctgtgacaacgtggcttcagaatcagaacaacgaaaggaacgaaacactgggctgg
ccggacttcgagtggcgcccgcctgtccctgagggctaccctgacggcatcgataaagta
gcggacgaagcacaagccaaagacttcttggtggagtacaacagcacggccgaagtggtg
tggaacgcctacagcgaggcgtcctgggcttacaacaccaacatcacggactacaacaag
caggtcatgctggagaagaacctggagatgtcagcccacaccctgaagcacggcatgcag
gcccggcagttcgactactctgacttccaggaccagagcgtcaagcgcatcctgaagaaa
ctgagcgacatcgagagggccgccctgcctgacctggagctgaaggagtacaacaacatc
ctctcggacatggagaccacatacagcatagccaaggtctgcaagggacaggacaagtgc
tatccattggatcctgacctcaccgacatcctagccaagtcgcgggattatgacgagctc
ctcttctcctggaagggctggcgggacgcctccgggaaggagatcaaaagcaaatacaag
agatacgtggagctgagcaacaaggcagccaggctcaatggtcacgaggacaatggggcc
ttctggagatccctctacgaaacggccaccttcgaagcggacctggagcagctgtaccag
cagctgcagcccctatacctcaacctgcatgcctacgtgcgccgcgccctctacaacaaa
tacgggcaggagcacatcaacctgaagggccccatcccagctcacctgcttgggaatatg
tgggcccagtcgtggtccaacatttttgacttggtgatgccctaccctagtgccacgaaa
gtggatgccaccccggccatgcaaaaacagggctggaccccggagaggatgtttcaagag
tcggataagttctttacttccctgggcctgatccccatgccgccagagttctgggccaag
tccatgattgagaagccagccggccgggaggtcgtgtgccacgcctctgcttgggacttc
tacaaccgcaaggacttcaggttgaagtaccaggggttgtgcccgcctgtgcccaggtcg
gaggatgactttgatcctggtgcgaagtttcacatcccggccaacgttccctatgtcagg
tactttgtcagttttgtgatccagttccagttccaccaagccctctgcaaagccgccccc
gccatgtcggctgatgccctgatgacctacttcaagccgctgactgactggctgatccag
gagaacaccaagaacggggagaccctgggctggcccgagtacaactggacgccgtatgcg
ggtacttccagcggggggtgtcaagcacagtctagtgccagagtcagtttcctgggaatg
tcactggataggaaccaagccgccgcaggacagtgggtcctgcttgtcctcggactgctc
ctcttgattgccactgttgtcctgggagtcaaattctgctcctcaaggagaagggcccag
aaatccagctcggaaatggaactgaaataa

DBGET integrated database retrieval system