KEGG   Chelonia mydas (green sea turtle): 102934001Help
Entry
102934001         CDS       T02989                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00010  Glycolysis / Gluconeogenesis
cmy00051  Fructose and mannose metabolism
cmy00052  Galactose metabolism
cmy00500  Starch and sucrose metabolism
cmy00520  Amino sugar and nucleotide sugar metabolism
cmy00524  Neomycin, kanamycin and gentamicin biosynthesis
cmy01100  Metabolic pathways
cmy01200  Carbon metabolism
cmy04910  Insulin signaling pathway
Module
cmy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cmy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102934001 (HK1)
   00051 Fructose and mannose metabolism
    102934001 (HK1)
   00052 Galactose metabolism
    102934001 (HK1)
   00500 Starch and sucrose metabolism
    102934001 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102934001 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102934001 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102934001 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmy04131]
    102934001 (HK1)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102934001 (HK1)
Membrane trafficking [BR:cmy04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102934001 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102934001
NCBI-ProteinID: XP_007054716
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYFFTELKDDQVKKIDKYLYSMRLSDETLLDIMARFKREMQNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMETEIYNTPEDIMH
GTGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVTRLRTTVGVDGSLYKMH
PQYARRLQKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQIKNRMRIEIEAGLRKKTHENAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVSCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKTTDCEGEDVVYLLREGIRRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNVEMVEGDQGRMCVNMEWGAFGDNGCLDD
IRTSYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISESLKTRG
IFETKFLSQIESDRLALLQVRTILQQLGLNGTCDDSIIVKTVCGAVSRRAAQVCGAGMAA
VVDKIRENRGLDHLEVTVGVDGTLYKLHPHFSRIMHQTVKDLAPKCNVTFLLSEDGSGKG
AALITAVGCRLRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgcccagctgctggcctatttcttcacagaattgaaggatgatcaggtcaaa
aagattgataaatatctttattccatgcggctctctgatgaaacactgctggatattatg
gctcgcttcaagagggagatgcaaaatggtctttctagagacttcaatccaacagccaca
gtaaaaatgcttcctacatttgtaaggtcaattcctgatggctcagagaaaggagatttc
attgcattggatcttggtggatcttattttcgaattctgcgagtgaaggtctctcatgag
aaaaagcagacagtacaaatggaaactgagatttataacacaccagaagatatcatgcat
ggcactggaacccggctctttgatcatgttgctgaatgcctgggagatttcatggagaag
caacaaatcaaggacaagaaattgccagttgggtttacattttctttcccttgtagacaa
tccaagctagatgagggtgttctgataacctggacaaaacgcttcaaagcaagtggagtt
gagggagcagatgtagtaaagctgctcaacaaggcaatcaagaaacgtggggactatgat
gcagacatcatggctgttgtaaatgacacagtaggaacaatgatgacctgtgggtttgat
gaccagcgttgtgaagttggcttgattataggtactggcacgaatgcctgctacatggaa
gaaatgaggcatattgatctggtagaaggtgatgaggggaggatgtgcattaacactgag
tggggagcctttggagatgatgggtcactagaagacatcagaactgagtttgacagggag
attgaccgtggatccctcaatcctggaaaacaactgttcgagaagatggtcagtggactg
tacatgggtgagctggtcaggcttatccttgtaaagatggccaaagaggggctacttttc
gaggggcgaatcactccagagcttttaaccaaaggaaaatttgaaacaaaacatgtgtct
gccatagaaaaaagcaaagaaggtctgaataaagccaaagaaattttgacacgtcttggg
gtagaaccatcccatgaagactgcattgctgtccagcacgtctgtacaattgtttcattc
cgttctgctaatctggtggctagtactttgggcgcgattctgaatcaattgcgtgataat
aaaggagtaaccaggctgcgcaccacggtgggtgtggatggttccctttacaagatgcat
ccacaatatgccagacgcttgcagaaaacaacgaggcgattagttcctgactctgaagtg
cgattccttctgtctgagagtggcagtggaaagggtgctgcaatggtcacagcagtagca
tacaggttgtctgagcagcacaggctgatagatgagactctggctgaattcaagcttact
cacgagcagctgttgcagattaaaaacaggatgcgaatagaaatagaagctgggctgagg
aagaaaactcatgaaaatgcaaaagtaaaaatgctgcctacctttgttcgcagcacacca
gacggaacagagaatggagattttctggctcttgatctgggaggaacaaacttcagagtt
ttgcttgtgaagatccgtagtggtaaaaggagaacggttgaaatgcacaataaaatatat
gctattcctatagaggtcatgcagggtactggagaagaactgtttgatcacattgttagc
tgtatctcagacttcctggattacatgggaataaaaggcgcacgacttccccttggcttt
acattttccttcccttgcaagcagaccagtttagatgctggtatcctcctcaactggacc
aaaggctttaaaactacagattgtgaaggagaggatgtagtatatttgcttagggaaggc
attagaaggagagaggaatttgacttagatgttgtggcagtggtgaatgatacagttggc
acgatgatgacttgtgcatatgaagatccaaattgtgaaataggactcattgtgggcact
ggcagcaatgcatgttacatggaggaaatgagaaacgtagagatggtagagggagatcaa
ggacgaatgtgtgtgaacatggaatggggtgcatttggagacaatggatgcctggacgac
atcaggacaagttatgacaaagctgtcgatgattattcgttaaatgctggaaaacaaagg
tatgagaaaatgattagtggaatgtacctgggagaaatcgttcgcaatattttgattgac
ttcactaaaaggggattcctatttagaggtcaaatttcagagtcgttgaagaccagaggt
atctttgaaaccaagttcctttcacagattgagagtgacaggttagcattgcttcaggta
cgaacaatcctccagcagctgggcttgaatggtacctgtgatgacagtataattgtaaag
acggtttgtggagcagtatcgagaagagcagctcaggtgtgtggagctggaatggctgca
gttgtagataaaataagagagaacagaggattagaccacctggaagtaacagttggtgta
gatgggactctgtataaactacatccacacttttcaaggatcatgcaccaaacagtaaag
gatcttgcaccaaaatgcaatgtgacattcctcctttcggaagatggcagtgggaaagga
gcagctctcattactgctgtgggatgtagacttcgtgatgctgagcaaaactaa

DBGET integrated database retrieval system