KEGG   Chelonia mydas (green sea turtle): 102934406Help
Entry
102934406         CDS       T02989                                 

Gene name
COL5A1
Definition
(RefSeq) collagen type V alpha 1 chain
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cmy00536]
    102934406 (COL5A1)
Glycosaminoglycan binding proteins [BR:cmy00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   102934406 (COL5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 102934406
NCBI-ProteinID: XP_007061068
LinkDB All DBs
Position
Un
AA seq 1838 aa AA seqDB search
MDTHTRWKRRSWIRTKTIAIFLLYAISQSRAAEPADLLKVLDFHNLPDGITKTTGFCTSR
RSSKGADVAFRVTKDAQLSAPTKQLYPASAFPEDFSILSTVKAKKGGQSFLISIYNEQGI
QQIGMEMGRSPVFLYEDHTGKPGPEDYPLFRGINLSDGKWHRIAISVQKKNVTLILDCKK
KVTKFLDRSDHPIIDVNGIIVFGTRILDEEVFEGDIQQLLIVADPRAAYDYCEHYSPDCD
TAIPDTPQSQDPNQDEYYTEGDGEGDTYYYEYPYYEDTDDTGKEEAPTAKPIDAEEAARE
VTEIKEELTPLPTQAPTVVENVEETKEDEKLDDPIVDEYNYETINEEYYTPLPYEDLNYE
DIDTQDTLTEEAVEAEVPASTVITPTATNAEVETGQEGDDQDKDFTEETIKEYDGNYYDT
YYDRTVSPDIGPGMPANQETEYEGIGGPRGEKGQKGEPAIIEPGMLIEGPSGPEGPAGLP
GPPGTTGPVGPLGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFSGGGDGGSKGPLVS
AQESQAQAILQQARLALRGPAGPMGLTGRPGPVGPPGSGGLKGDSGDMGPQGPRGIQGPP
GPSGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGAPGDD
GERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPSGPPGVTGMDGQTGPKGNVGPQGEPGPP
GQQGNPGAQGLPGPQGAIGPPGNKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGSQGPT
GPQGPLGYPGPRGVKGADGVRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGED
GPEGPKGRGGPNGDPGPLGPSGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGR
GTPGKPGPRGQRGPTGPRGERGPRGSTGKPGPKGNSGGDGPPGPPGERGPPGPQGPTGFP
GPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPP
GPPGEQGLPGLAGKEGTKGDPGPAGLPGKDGPPGLRGFPGERGLPGPVGALGLKGSEGPP
GPPGPAGSPGERGPAGSAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGIQGPV
GLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPLGQPGPAGADGEP
GPRGQQGLFGQKGDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPS
GPPGADGPQGPPGGIGNPGAVGEKGEPGESGEPGLPGEGGPPVSGERGEKGEAGPSGAAG
PPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPTGDKGDDGEPGQTGSPGPTG
EPGPSGPPGKRGPPGPAGPEGRQGEKGAKGESGLEGPPGKTGPVGPQGAPGKPGPDGLRG
IPGPVGEQGLPGSPGPDGPPGPLGPPGLPGLKGDSGLKGEKGHPGLIGLIGPPGEQGEKG
DRGLPGPQGSSGPKGEQGITGPSGPIGPPGPPGLPGPPGPKGAKGSSGPTGPKGESGHPG
PPGPPGPPGEVIQPLPIQSSKRTRRNIDASQLVDEGNTDNYMDYADGMEEIFGSLNSLKL
EIEQMKHPLGTQHNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGETC
IFPDKKSEGARITSWPKETPGSWFSEFKRGKLLSYVDSDGNPIGVVQMTFLRLLSASANQ
NITYNCYQSVAWQDATTGSYDKAIRFLGSNDEEMSYDNNPYIRAVLDGCATKKGYQKTIL
EVNTPKVEQVPIVDILFNDFGEASQKFGFEVGPACFMG
NT seq 5517 nt NT seq  +upstreamnt  +downstreamnt
atggatacacacacaaggtggaaaagaagaagttggataaggaccaaaacgatagcaata
tttctactctatgcaatttctcaaagcagagcagctgaacctgcagatctcttgaaggta
ttagattttcataatttacctgatggtatcactaaaacaacaggtttttgcacaagcaga
agatcttcaaaaggtgcagatgttgcttttcgagtaacaaaagatgctcagctcagtgca
ccaacaaagcagttatatcctgcttcggcctttccggaggacttctccattctgtccact
gtaaaagccaagaaaggaggtcagtccttcttgatctccatttacaatgagcaagggatc
cagcagattggcatggagatgggtagatctcctgtattcctgtacgaagaccataccggg
aagccaggcccagaagactatcctctctttcgaggcattaacctctcagatggcaagtgg
cacagaatagccatcagtgtacagaagaaaaacgtcactttgattctggactgtaaaaag
aaggtaactaagttcttggaccgaagcgaccaccccatcattgacgtcaacggcatcatt
gtgtttggaaccaggatactggatgaggaagtctttgagggggacatccagcagctcctg
atcgtggcagaccccagggcagcctatgattattgtgaacactacagccctgactgcgac
acagccattcccgacaccccccagtctcaggaccctaaccaagatgaatactacactgag
ggggatggtgaaggtgatacctattattatgaatatccctactacgaggacaccgatgac
acaggaaaggaagaagcacccactgccaagcctattgatgctgaagaagctgctagagag
gtgactgaaattaaagaggagctcacccctctgcccacacaagcacctacagtggtggaa
aacgtggaggagacgaaagaggatgagaagctggatgaccccatcgtggacgaatataat
tatgaaaccattaacgaggagtattacactcccctcccttacgaggacctcaactatgag
gatatagacactcaggatacccttactgaagaagctgtcgaagcggaagtcccagccagc
acagtcatcacccccaccgcaaccaatgccgaggtggaaacgggtcaagagggagacgac
caagataaagactttactgaagagacaataaaagagtatgatgggaattactatgatacc
tactatgaccgaactgtctctcctgatattgggccaggaatgcctgctaaccaagaaaca
gagtatgaagggattggtggcccacgaggtgagaaaggacagaagggagagcctgcaata
attgaaccgggcatgctcatcgaagggccatccggtcccgaaggcccagctggtcttcca
ggacctccgggaactactgggcctgtcggtccactgggtgaccctggcgagagaggacct
cctggccggccaggtcttccaggagcggatgggttacccggaccaccagggacaatgctc
atgctgcctttccgctttagtgggggaggagatggtggctcaaaaggacctctcgtttca
gcacaggaatcccaagctcaagccatactgcaacaagccaggttggcgttgagaggacct
gctggccctatgggtcttactggaagaccaggccccgtgggacccccaggcagtggagga
ctaaaaggtgactcaggagacatggggcctcagggtccacgaggcattcaaggcccccca
ggcccatcaggaaaaccaggccgcaggggacgggctggcagcgatggtgcccggggaatg
ccagggcagacaggaccaaagggtgaccgaggttttgatgggttagctggtttgcctggt
gagaaggggcacaggggtgatccaggcccatcaggtccaccaggagcacctggagatgac
ggggagaggggtgatgatggagaagttggacccagaggtctacctggagaacctggaccc
cgaggtttgctaggaccaaaagggccaccaggtccctcaggaccgccgggtgtgactggt
atggatggacaaacaggcccaaaggggaatgtgggtcctcaaggtgagccaggaccgcca
ggacaacagggtaatccaggtgctcagggtcttccaggtccacagggtgcaattggtcca
ccaggcaataaaggacctctgggtaaacctggtcttcctggcatgcccggtgcagacggc
cctccgggtcatcctggcaaagaaggtcctcctggtgagaaggggagtcagggtccaact
ggacctcagggcccacttggatatccaggacctcgtggagtcaagggggcagatggagtt
cgtggcttgaagggcactaagggtgaaaagggtgaagatggcttccctggcttcaaaggt
gacatgggcatcaagggagaccggggtgagattggtcctcccggcccacggggtgaagat
gggcctgaaggtcctaaaggtcgcggaggtcctaatggagatccaggtcctcttggtccg
tcgggggaaaagggaaaacttggagttccagggctcccaggttatccaggaaggcaaggt
ccgaagggttcaatcggattcccaggattcccaggagccaacggagagaagggtggaagg
ggtacacctggcaaaccaggtccaagggggcaacgaggtccaacgggtccacgtggtgaa
agaggtccgaggggcagcactggaaagcctggccctaagggcaactctggtggtgatggg
ccccctggtcctcctggcgaaaggggaccgccaggacctcaaggaccaactggatttcct
ggaccaaaaggcccccctggtccaccagggaaggatggattgcccggtcaccccggacag
agaggtgaaactggtttccaaggcaagacaggtcctccaggccctccaggtgttgttggc
ccgcagggtcctactggagagacgggtccaatgggtgagcgtgggcatccaggtccaccg
ggtccaccaggtgagcaaggtctacctggcctggctggaaaggaaggaaccaagggtgac
ccgggacctgctggccttccaggaaaagatggccctcctggcttaagaggcttccctggt
gaaagaggtctccccggcccagttggagctcttgggctgaaaggcagtgaaggtccccct
ggtccaccaggcccagcagggtctcctggtgagagaggtccggctgggtcagctggccca
attggtttaccaggaagacccggaccccaaggacctccaggacctgctggtgaaaagggt
gccccaggtgagaaaggcccgcaaggcccagctggtcgtgatggtattcagggcccagtt
ggactcccaggcccagcaggtcctgttggccccccaggagaagacggggataagggcgag
attggagaaccaggccagaaaggaagcaagggtgacaaaggagaacagggtccaccgggt
cctactggaccacaaggtccacttggtcaaccaggtccagctggagctgatggggagcca
ggtccaagaggacaacaaggcctctttggtcagaaaggtgatgaaggtccaagaggtttc
cctggtcccccagggccagtgggcttgcagggtttgcctggaccacctggtgagaaggga
gaaacaggtgatgttggacaaatgggcccaccaggtccccctgggcccaggggtccatcc
ggaccaccaggagcggatggtccacaaggtcctccgggtggaataggaaatcctggagct
gtaggagagaagggtgaacctggtgaatctggtgagcctggtcttcctggagagggtggt
cccccggtaagtggagaaagaggtgaaaagggagaagcaggcccctccggtgctgctggt
cctcctggccctaaaggtccaccaggtgatgatggacctaaaggtagccctggtccagtt
ggttttcctggtgatcctggtccccctggagaacctggcccagctggtcaagatggtccc
accggtgacaagggtgatgatggtgaacctggtcagactggatctcctggcccaactgga
gaaccaggcccatcaggtcccccggggaagaggggtcctcctggtccagcaggtcctgaa
ggaagacaaggagagaaaggagccaagggtgaatctggcctggaaggacctcctgggaag
acaggtcctgttggtccccagggagctccagggaaacctggtcccgatggccttcgagga
attcctggcccagtgggtgaacaagggctccccggttccccaggccccgatggtcctcca
ggcccactgggcccacctggtttacctggtcttaagggagattcaggtcttaaaggtgaa
aagggtcatccaggtttaattggcctcattgggccccctggtgagcagggagaaaagggt
gacagaggtctcccaggaccccaaggttcatccggacctaaaggagagcagggtatcacc
ggtccttctggtccaattggacctccaggtccaccaggattaccgggtccccctggtcca
aaaggtgctaaagggtcatcaggcccaacgggtccaaagggtgaatctggccatccaggc
ccaccaggacctcccggtcctcctggggaagtaatccagcccctgcctatccagtcctcc
aagaggaccaggcgtaacattgatgcaagccaactggttgatgagggaaacaccgacaac
tacatggattatgcggatggcatggaggagatcttcggctccttgaactctttgaaactg
gaaattgagcaaatgaagcatcctttgggcactcagcataacccagctcgtacctgcaag
gacttgcagctgtgccaccctgacttcccagatggtgaatactgggttgatcctaatcaa
ggatgttcaagggactctttcaaagtttactgtaacttcacagctggtggagagacctgt
atcttccctgataagaaatctgaaggagctagaattacttcttggccaaaggaaaccccg
ggctcctggttcagtgaattcaagcgcggtaaactgctttcctacgtggattcggacggc
aatcccatcggagtggtgcagatgactttcctgaggctcttgagcgcctccgcaaaccag
aacatcacctataattgctaccagtctgtagcatggcaggatgccaccacaggcagctac
gacaaagccatccgcttcctgggctccaacgatgaggagatgtcctacgacaacaaccct
tacataagggctgtcctagacggttgtgcaacaaagaaaggctatcaaaagactatcctg
gaggtcaacacacccaaagtagagcaagtacctatcgttgacatcctgttcaatgacttc
ggagaagcgtcacagaaatttggattcgaggtgggaccagcttgcttcatgggctaa

DBGET integrated database retrieval system