KEGG   Chelonia mydas (green sea turtle): 102934690Help
Entry
102934690         CDS       T02989                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00590  Arachidonic acid metabolism
cmy01100  Metabolic pathways
cmy04370  VEGF signaling pathway
cmy04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102934690 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102934690 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102934690 (PTGS2)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102934690 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 102934690
NCBI-ProteinID: XP_007056755
UniProt: M7C2Z8
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MILPCTLIIGLLAFSQAANPCCSNPCQNRGVCMTTGFDGYECDCTRTGFYGENCTTPEFL
TWLKLTLKPTPNTVHYILTHFKGVWNIINSIPFFRDSIMRYVLTSRSHLIDSPPTYNSQY
GYKNWEAYSNLSFYTRTLPPVALDCPTPMGVKGKKELPDSAIVVEKFLLRKKFIPDPQGT
NMMFTFFAQHFTHQFFKTDHHRGPAFTKALGHGVDLNHVYGETLDRQLKLRLLKDGKLKY
QMIDGEMYPPTVKDTEAEMIYPPHIPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQVHPEWDDEQLFQTTRLILIGETIKIVVEDYVQHLSGYYFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDSFQIHDQEYTFQQFLYNNSIMMEHGLSHMVKSFSKQIAGRV
AGGKNVPFAVQKVAKASIDQSRQMRYQSLNEYRKRFLLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPGLLVERPRPSAIFGETMVELGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFEIINTASLQKLICNNVKGCPITAFHVLNSEATETATINVSSSSSAMEDINPTLLMKGR
SAEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgattctgccctgcactttaatcatcggtctcctggctttcagccaagcagctaatcct
tgctgctcaaacccatgccagaacagaggagtatgtatgacgacaggttttgatggatat
gaatgtgattgtacaaggacaggattttatggggaaaactgtactacaccggaattcttg
acctggctgaaactgacattgaaacctactccgaacactgtccactacatcctcactcac
ttcaaaggtgtctggaatataataaacagcattcccttcttccgtgattccatcatgaga
tatgtattgacatcaaggtcacatttgattgacagtccaccaacatacaacagccagtat
ggttacaaaaactgggaagcctattccaacctttccttctatactagaaccctcccacca
gtggcactggactgcccaacacccatgggtgttaaaggtaagaaggagctcccagattcc
gcaatagttgtggagaaatttctgctgaggaaaaaatttattcctgatcctcaaggcaca
aatatgatgttcacgttctttgctcaacatttcacccaccagttctttaagacagatcac
cacagagggccagccttcaccaaagctcttggccatggggttgacttgaaccatgtctat
ggagagactttggatagacaacttaagttgaggctacttaaggatggaaagctgaagtat
cagatgattgatggagaaatgtaccctcccactgtgaaggacactgaggcagaaatgatc
tacccacctcatattcctgagcacctgcaattttctgtaggccaggaggtgtttggtttg
gtcccaggtttaatgatgtatgccacaatatggctcagggagcacaatcgagtctgtgat
gttcttaagcaggtgcatccagaatgggatgatgagcagctgttccaaactaccaggctc
atattgataggagagactatcaagattgttgttgaagactacgtgcagcacttgagtggc
tactatttcaagctgaagtttgatcccgagctgctgtttaaccagcgatttcaatatcag
aatagaattgcagctgaattcaacactttgtaccactggcacccacttctgcctgacagt
tttcagatccatgaccaggagtacactttccagcaatttctctacaacaactctatcatg
atggaacatggcctttcccacatggtgaaatccttctccaagcaaattgccggcagggtt
gctgggggtaagaacgttccttttgcagtacagaaagtagctaaggcttcaattgatcaa
agcagacagatgagataccagtccttgaatgagtaccgaaaacgcttcctactgaaacct
tttaagtcatttgaggaacttacaggagaaaaagaaatggcagctgaattagaagagctt
tatggagatattgatgctatggagctgtatcctggccttctagtagaaaggcctcgtcct
agtgccatctttggtgagactatggtggaacttggagcaccattctctttgaaagggctg
atgggaaatgctatctgttctccggagtactggaaaccaagcacctttggtggaaaagtg
ggctttgaaataatcaatactgcctccctacaaaagctcatctgcaataacgtgaagggc
tgtcccatcaccgccttccacgtcctaaactctgaagccacagaaacggccaccattaac
gtcagttcctcgagctctgcaatggaggatatcaaccccacgttactaatgaaagggaga
tccgctgaattgtag

DBGET integrated database retrieval system