KEGG   Chelonia mydas (green sea turtle): 102935223
Entry
102935223         CDS       T02989                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04012  ErbB signaling pathway
cmy04068  FoxO signaling pathway
cmy04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102935223 (CDKN1B)
   04068 FoxO signaling pathway
    102935223 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102935223 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102935223
NCBI-ProteinID: XP_007056992
UniProt: M7BKQ5
LinkDB
Position
Un
AA seq 199 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHHKDMEEACQRKW
NFDFENHKPLAGRFEWQAVEKGSSPDFYFRPPRPPKVVCKAATHESLDVNGNCPTTVIVV
GSQGISEDTHFVDQKTDVSENQTDLADQCTGQRKRPATDDSSPQPKRANTTEEEVSEESP
SASSVEQTPKKSSPRRRQT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcaaacgttcgtatttcgaatgggagcccgaccctggagcggatggaagcccggcag
tcggagtatcccaagccttccgcttgcaggaacctctttgggcccgtgaatcacgaagag
ttaaacagggacttaaagaagcaccacaaggacatggaagaggcatgtcaaaggaagtgg
aattttgatttcgagaatcacaagcccctggctggcaggttcgagtggcaagcggtggag
aaagggagctcgcccgacttctacttcagacctccgaggccccccaaagtggtttgcaaa
gctgccacccatgagagtttggatgtaaatggaaactgcccaacaacggtgattgtagtc
ggttctcagggaatctcagaggacactcactttgtagatcaaaaaactgatgtatctgaa
aatcaaacggacttagcagaccagtgcactgggcaaagaaaacgaccagccacggatgat
tcttctcctcaacctaaaagagccaacacaacagaagaagaggtttcagaagaatccccc
agtgccagttcagtggagcaaacacccaagaaatccagcccaagaagacgtcaaacgtaa

DBGET integrated database retrieval system