KEGG   Chelonia mydas (green sea turtle): 102935642
Entry
102935642         CDS       T02989                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04020  Calcium signaling pathway
cmy04144  Endocytosis
cmy04510  Focal adhesion
cmy04540  Gap junction
cmy04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102935642 (PDGFRA)
   04020 Calcium signaling pathway
    102935642 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102935642 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102935642 (PDGFRA)
   04540 Gap junction
    102935642 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102935642 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102935642 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cmy04090]
    102935642 (PDGFRA)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102935642 (PDGFRA)
Protein kinases [BR:cmy01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102935642 (PDGFRA)
CD molecules [BR:cmy04090]
 Proteins
  102935642 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Pkinase_fungal C1-set
Other DBs
NCBI-GeneID: 102935642
NCBI-ProteinID: XP_007071163
LinkDB
Position
Un
AA seq 1081 aa
MELFMVLCTVMGTSPRTFLXXGCLLTGPWLTFCQLPLPTVLPNRDEMVVQLNASFTLKCS
GDSEVTWQYPLAEGSHRIDIRNEENNSGLFVTLLEVGNASAAHTGLYTCYYNHTQEEDGE
VEGKDIYIYVPDPDMPFVPLLPEDQFILVEDGDSTIIPCRTSDPNAQVALIDSEAKVVYA
YYDSKQGFLGNFPAGSYTCQTTVKGMEFKSDQFFIYIWKATSELPVEIEALQTVYKTGET
IVVTCVVFDNEVVNLQWNYPGKAKEKGVIKVDDIKVPSQKLVYTLTIPEASVKDTGDYEC
TARHATKEVKENKRVVITVHDKGFIHLDPQFSPLEAVNLHEVKNFVVDVQAYPAPKMFWL
KDNVTLTENLTEIVTSSNKINETRVQSILKLIRAKEEDSGDYTLVAENGEETKSYTFSLL
IQVSASILDLVDDHHGSGGGQTVQCLAKGTPFPDVEWLICKDIKKCSNDTSWMLLTNNIS
DIHMEAHRVDKDQVESQVTFQKVEETLVVRCMARNTLGAVTRELKLVAPTLRSELTVAAA
VLVLIVIVIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPR
DGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTH
LGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGM
NPADESTRSGSSEARQIDSRSLSNLLLYSTPDKKSKVSRRENFSRRPCEPEVKNLLSDDN
SDSLSLLDLLSFMYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHD
SNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSSFY
NKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGEYKKSYERIH
LDFLKSDHPAVTRMRVDCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIPLPDIDP
VSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSF
L
NT seq 3246 nt   +upstreamnt  +downstreamnt
atggaactattcatggtgctgtgcacagtgatgggtacttccccaaggacattcctgnnn
nagggatgtctcctgacaggaccatggctaactttttgccagcttccattgccgactgtt
cttccgaatagagatgaaatggtcgtgcagctgaatgcctcgtttaccctgaaatgctct
ggagacagcgaagtgacctggcaatacccactggctgaaggaagccacaggatagacatt
agaaatgaagagaacaacagtggtctctttgtgactttgctggaagtggggaatgcctca
gctgctcataccggattatacacttgttactacaatcatactcaagaggaggacggggag
gtggaggggaaggacatctacatctatgtgcctgatccagatatgcccttcgttcctctg
ctaccagaggatcaattcatcctagtagaagatggtgattccaccattatcccttgtcgt
acaagtgaccctaatgctcaagtagctttaattgacagtgaagcaaaggttgtatatgcc
tattatgacagcaaacaaggcttcctaggaaattttcctgcaggctcatacacgtgccaa
acaactgttaaaggaatggagttcaagtcagatcagtttttcatctacatttggaaagct
acttcagagctgccagttgagattgaggctcttcaaacggtatataaaacaggcgaaacg
attgttgtaacttgtgtggtctttgacaacgaggtggttaatttacagtggaattatcca
gggaaagcgaaagaaaaaggtgtgataaaagttgatgacattaaagttccatcccagaag
ctggtttacactttgactattcctgaggcttcagtgaaagataccggggattatgaatgt
acggcccgacatgcaaccaaggaggttaaagaaaataagagagtagtcattacagttcat
gataaaggattcattcatctggatccccaatttagccctttggaagctgtcaatttacat
gaggtcaaaaattttgtagtggatgtgcaggcgtacccagctccaaaaatgttctggctg
aaggacaatgtgactctgactgagaatcttacagagattgttaccagctcaaacaagatc
aatgagacaagggtccaaagtatattaaaactgattcgggccaaggaagaagacagtgga
gattatactttggttgctgaaaatggagaagagactaaaagctacactttctcattgcta
atacaagtgtcagcttcaattctagacctggtggatgatcaccacggctctggaggggga
cagacggtccaatgcttggcaaaagggacgcctttccctgacgtggaatggctgatatgc
aaggacattaaaaaatgcagtaatgatacctcatggatgcttctgactaacaacatctca
gatatacacatggaggctcatcgggttgataaggaccaggtggaaagccaggtgaccttc
caaaaggtagaagaaaccctggtagtacggtgcatggcgaggaacactcttggtgccgtt
actcgggaactgaagcttgtggcgcctacattgcgatcagaattaactgtggctgcagca
gtcctagtgttaatagtgattgtgattatttcactgattgtcctggtcatcatatggaaa
cagaaaccaaggtatgagataagatggagagtcattgagtccatcagccctgatggccat
gagtacatttatgtggacccaatgcaactgccctatgactcaagatgggagtttcctaga
gatggattagtacttggtcgaatccttggttcaggcgcgtttgggaaagttgttgaagga
actgcatatggattaagtcgctctcagccagtgatgaaggtagctgtgaaaatgctgaaa
cccacagctagatccagtgaaaaacaggcactaatgtctgaactgaagataatgacacat
cttgggccccatttgaacattgtgaatctcttaggagcttgcactaaatcaggtccaatt
tacatcattactgaatactgcttttatggggatttggtaaactacctgcataaaaacagg
gataatttcctgagccgacatccagaaaagccaaagaaggacttggacatttttgggatg
aacccagctgatgaaagcacaagaagcggttctagtgaagcccgccaaatcgacagcaga
tcgctttccaatctactcctgtactctacccctgacaagaagagtaaggtaagtcgacgg
gagaatttctcccgtcgaccctgcgaaccagaagtcaaaaacctgctttctgatgacaat
tctgacagcctcagtttgctggatttactaagcttcatgtaccaagttgcacgggggatg
gagttcttggcttctaaaaattgtgtgcaccgtgacttggcagctcgtaatgtccttctg
gctcaaggaaaaattgtgaagatctgtgactttggtctggctagggacatcatgcatgat
tccaactatgtctccaaaggcagcacttttctcccagtgaaatggatggcacctgaaagc
atttttgacaatctgtacacaacattaagtgatgtctggtcttatggcattctgctgtgg
gagatattttctcttggtggcacaccataccctggcatgatggttgattcttctttctac
aacaagataaaaagtggctaccgaatggcaaaacctgaccatgctaccagtgaagtgtat
gaaattatggtgaaatgttggaacagcgagccggagaaaagaccttctttttaccatttg
agtgaaattgtggagaatctgttgcctggcgagtacaagaagagctatgaaaggattcat
ctggacttcctgaaaagcgaccacccagcggtcacacgcatgagagtggactgtgacaac
acctacatcggtgtcacttacaagaatgaagacaagctaaaggacagggagagtggattt
gatgagcagaggttgagtgctgacagtggctacatcatccccctgcctgacattgatccc
gtctccgaggatgaactcggcaaaaggaacaggcacagttcccagacatctgaagaaagt
gccattgagactggttctagcagctctacctttatcaagcgagaggatgagaccattgag
gacattgacatgatggatgacattggaatagattcctcagacctggttgaagacagcttc
ctgtaa

DBGET integrated database retrieval system