KEGG   Chelonia mydas (green sea turtle): 102936491
Entry
102936491         CDS       T02989                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102936491 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102936491 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cmy04052]
    102936491 (KITLG)
Cytokines and growth factors [BR:cmy04052]
 Growth factors
  Growth factors (RTK binding)
   102936491 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102936491
NCBI-ProteinID: XP_007059271
LinkDB
Position
Un
AA seq 282 aa
MKKTQTWIITCFYLQLLLLNPLVKAQSPCGNPVTDDVNDITKLVGNLPNDYRITLRYVQK
MDTLPNHCWLHLMVPEFSKSLHHLLQKFSDMSDVLSNYSIINNLTRIINDIMSCLDSEKN
KNFRKESRHLYEEGRFIPEEFFRYFNSTIEVYKDFAETSDHSDCVLPSTTETPENNPRVS
VTKPFLLPPVAASSLRNDSSDNNSNSNKEALDFISSPSLKGISIALPSLFSLLIGFTLGA
ICWKKTHRTPRPESDETTQCNNCQEDNEISMLQQKEKELLQV
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcttttatcttcaactgctcctacttaat
cctcttgtcaaagcccaaagtccctgtgggaatccagtgacagatgatgtgaatgacatt
acaaaactggttggaaatcttccaaatgattataggataacccttaggtatgttcagaag
atggatactctgcctaatcactgttggttacatttgatggtgcctgagttttcaaagagt
ctgcatcatcttctgcaaaaattttcagatatgtctgatgttttaagcaactattcaatc
atcaataatctcacgaggataatcaatgatattatgtcatgtctagattctgagaaaaat
aagaattttagaaaagaaagtcgtcatctttatgaagaaggcaggttcattcctgaagaa
ttctttaggtactttaacagcaccattgaagtctacaaggattttgcagaaacatcggat
catagtgactgtgttctgccgtcaacaacagaaacaccagagaacaatccaagagtcagt
gtaacaaaaccatttttgttacctcctgttgctgccagctcccttaggaatgatagcagt
gacaataacagtaacagtaacaaagaggcactcgacttcattagcagccccagcctgaaa
gggataagcatagcattgccgtcattgttttctcttcttatcggctttactttgggagcc
atctgctggaagaaaacacatcgcacacccagaccagaaagtgatgaaacaacacagtgt
aataactgtcaagaggataatgagataagtatgttgcagcaaaaagaaaaagagctctta
caagtgtaa

DBGET integrated database retrieval system