KEGG   Chelonia mydas (green sea turtle): 102936498
Entry
102936498         CDS       T02989                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
cmy  Chelonia mydas (green sea turtle)
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 DUF5111
Other DBs
NCBI-GeneID: 102936498
NCBI-ProteinID: XP_007061892
LinkDB
Position
Un
AA seq 274 aa
MSECEPGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSFIRKPLKDKVRQRRSPEP
DPPILTQAEIEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLIRPVSVPASKKAPSI
QNANKALRSQVVTRRTSFYLPKDTVKHLHIISRTRASEVIEALLKKFMVVDNPRKFALFE
RVEKDDQVYLRKLSDEEQPLHLRLLAGPNEKVLSFVLKENETGEVNWDAFSMPELHNFLR
ILQREEEEHVRQILQKYARCRQKMQEALTTRTPG
NT seq 825 nt   +upstreamnt  +downstreamnt
atgagcgagtgcgagccggggaccccgtccttcgaaatgacctggagcagcaccaccagc
agcggctattgcagccaggaggactcggactcggagctggagcagtacttcacggcgcgc
acttccttcatccgcaaacccctcaaggacaaggtgaggcagagacggagccccgaaccg
gatccccccattctgacccaagccgagatcgagcagaagataaaggaatacaacagccag
atcaacagcaacctcttcatgagcttgaacaaagacggctcctacactggcttcatcaag
gtgcagctgaagctgattcggccggtctcggtgccagccagcaagaaggcgccctccatt
cagaacgccaataaggcgctgcgctcccaggtggtgacgcgccgcacgtccttctacctg
cccaaggacacagtcaagcacctgcacatcatctcccgcacccgcgccagcgaggtcatc
gaggccctgctcaagaagtttatggtggtcgacaatccccgcaagttcgccctcttcgag
cgagttgagaaggacgaccaagtgtacctgcggaagctctcagatgaggagcagcccctg
catctccggctgctggctggccccaatgagaaggtcctcagcttcgttctgaaggagaac
gagaccggagaggtcaattgggacgccttcagcatgcctgagctgcacaacttcctgcgc
atcctgcagcgtgaggaggaggagcacgtccgccagatcttgcagaagtacgcccgctgc
cgccagaagatgcaggaggcactgactacccgcaccccgggctga

DBGET integrated database retrieval system