Chelonia mydas (green sea turtle): 102936684 Help Entry 102936684         CDS       T02989                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cmy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102936684  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmy04121]     102936684    03400 DNA repair and recombination proteins [BR:cmy03400]     102936684 Ubiquitin system [BR:cmy04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      102936684    Cul5 complex      102936684 DNA repair and recombination proteins [BR:cmy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102936684 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  102936684 NCBI-ProteinID:  XP_007069178 UniProt:  M7BFN9 LinkDB All DBs Position 7:complement(56525576..56532705) Genome browser AA seq 121 aa AA seqDB search MDVFLMIRRHKMTIFADAKETTTVQELKKIVGGILKRPPEEQQLYKDDWLLEDGDRTLIE CGLSSQTSRPHAPAMVGLALFRASEGSFEPLHIDPFSSTPELPDVLKPQDSGSSSCEQPM Q NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggatgtcttcttgatgatccgtcgccacaaaatgaccatctttgctgatgccaaggag actaccactgtgcaggagctgaagaagattgtggggggcatcctgaagaggcctccggag gagcagcagctatacaaggatgactggttgctggaggatggtgacaggaccttgatagaa tgtgggttaagcagccagacttcccgtccccatgcgccagccatggtgggcttggcctta ttcagagccagtgagggctcctttgagccattgcacattgaccccttctccagcacccct gagctgcctgatgttttgaagcctcaagattctggcagcagctcctgcgagcagcccatg cagtga

DBGET integrated database retrieval system