KEGG   Chelonia mydas (green sea turtle): 102937326
Entry
102937326         CDS       T02989                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102937326
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cmy04052]
    102937326
Cytokines and growth factors [BR:cmy04052]
 Cytokines
  CSF and other factors
   102937326
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102937326
NCBI-ProteinID: XP_007056843
LinkDB
Position
Un
AA seq 109 aa
MLESWSALPLLLLGLAALTCPSPLHPICDARVMEKFIKEARDTENAMRQTQAAGGWGLLS
AAVLRARDLVPDPSLSQQLGRTYSNLRGVTQILRSHNAQVEPALPPAPP
NT seq 328 nt   +upstreamnt  +downstreamnt
atgctcgagtcatggagtgctttgccgttgttactgctgggactcgctgcgctaacttgc
ccctccccgctgcaccccatttgcgatgctcgagtcatggagaaattcatcaaggaggcc
agagacactgagaacgccatgaggcagacgcaggcggcgggggggtgggggctactctcg
gccgccgtgctccgggcccgggacctggtccccgacccgtccctgagccagcagctgggc
cgcacctacagcaacctgcgcggcgtcacccagatcctgcgcagccacaacgcccaggtg
gagccggccctgccaccggccccgccgc

DBGET integrated database retrieval system