KEGG   Chelonia mydas (green sea turtle): 102938465Help
Entry
102938465         CDS       T02989                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00250  Alanine, aspartate and glutamate metabolism
cmy00410  beta-Alanine metabolism
cmy00430  Taurine and hypotaurine metabolism
cmy00650  Butanoate metabolism
cmy01100  Metabolic pathways
Module
cmy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102938465 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102938465 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102938465 (GAD2)
   00430 Taurine and hypotaurine metabolism
    102938465 (GAD2)
Enzymes [BR:cmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102938465 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102938465
NCBI-ProteinID: XP_007058543
LinkDB All DBs
Position
Un
AA seq 471 aa AA seqDB search
MDILLQYVVKSFDRSTKVIDFHYPNELLQEHNWELADRPQTLEEILLNCRTTLKYAIKTG
HPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLRKMREMIGWPGGC
GDGIFSPGGAISNMYAMLIARFKMFPEVKEKGMAAIPRLVALTSEHSHFSVKKGAAALGI
GTDSVILIRCDERGKMIPSDLERRIIEAKQKGFVPFLVSATAGTTVYGAFDPLLAIADIC
KKYKIWMHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGL
MQSCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAQIDKC
LELAEYLYNKIKNREGYEMVFDGKPQHTNVCFWYVPPSLRSMEDNEERMNRLLKVAPVIK
ARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatattttgcttcagtatgtggtgaaaagttttgatagatcaacaaaggttatcgat
ttccattatccaaatgagcttctacaggaacataactgggaactggcagaccgaccacag
accttggaagaaattttgttgaactgcagaacaactctaaaatatgccatcaaaacaggg
catcctcgatatttcaatcaactttcaactggattggacatggttggattagctgcagac
tggctgacatcaacagcaaatactaatatgttcacctatgaaattgctccagtgtttgta
cttttggaatatgtcacgctaaggaaaatgagagaaatgattggctggccagggggctgt
ggcgatgggatattttcacctggtggtgccatatctaacatgtatgctatgttgattgca
cgtttcaagatgttcccagaagtcaaagagaaaggaatggcagctattcccaggctggtt
gccctcacctcagagcatagtcacttttctgtgaagaagggagctgcagccttggggatt
ggcacagatagtgtgattctgattagatgtgacgaaagagggaaaatgatcccatcagac
cttgaaagaagaattattgaagccaaacaaaaaggatttgttcctttcctagttagtgcc
actgcaggaactacagtgtatggtgcatttgatccactcctagctattgcagacatctgc
aagaaatacaaaatctggatgcacgtggatgcagcatggggtggcgggctgctgatgtct
aggaaacataaatggaaattaaatggtgttgaaagggccaattctgtgacttggaacccc
cacaagatgatgggtgtcccattgcagtgttctgcccttctcgttagggaagagggcttg
atgcagagctgcaatcaaatgcatgcttcctacctctttcaacaagataaacactatgac
ctgtcatatgacactggagacaaggcgttgcaatgcgggcgtcatgttgatgtcttcaag
ctatggctgatgtggagagcaaagggaactacaggatttgaagcacaaattgacaagtgc
ttggaacttgcagaatatctatataataaaataaagaacagagaaggctatgaaatggtg
tttgatggaaagcctcagcacacaaatgtctgcttctggtacgtacctcccagtttgcgc
agcatggaggacaacgaagaaagaatgaatcgccttctaaaggtggccccagtgataaaa
gccagaatgatggaatacggaactactatggtcagctatcaaccgctgggagacaaagtg
aacttcttccgtatggtcatctcaaacccagcagctactcatcaagacattgatttcctg
attgaggaaatagaacgtctggggcaagatttataa

DBGET integrated database retrieval system