KEGG   Chelonia mydas (green sea turtle): 102938595Help
Entry
102938595         CDS       T02989                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04012  ErbB signaling pathway
cmy04068  FoxO signaling pathway
cmy04150  mTOR signaling pathway
cmy04270  Vascular smooth muscle contraction
cmy04510  Focal adhesion
cmy04810  Regulation of actin cytoskeleton
cmy04910  Insulin signaling pathway
cmy04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102938595 (BRAF)
   04012 ErbB signaling pathway
    102938595 (BRAF)
   04068 FoxO signaling pathway
    102938595 (BRAF)
   04150 mTOR signaling pathway
    102938595 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102938595 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102938595 (BRAF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102938595 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102938595 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102938595 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102938595 (BRAF)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102938595 (BRAF)
Protein kinases [BR:cmy01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102938595 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 102938595
NCBI-ProteinID: XP_007072358
LinkDB All DBs
Position
Un
AA seq 755 aa AA seqDB search
MIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVS
SSASTDTVTSSSSSSLSVAPSSLSVYQNPTDMSRNNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPISQEEASLGETTQASGSYSSVPPSDSIGPPILPSPSPSKSIPIPQPFRPADED
HRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLRGEGAPLNQLMRCLRKYQSRTPSP
LLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTSVKALQKSPGPQRERKSSSSS
EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTP
QQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIK
LIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQ
LSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRG
YLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPS
LNRAGFQTEDFSLYTCASPKTPIQAGGYGEFAAFK
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattaacacaagaacacatagaggcgctgctggacaagtttggaggagagcat
aacccaccatcaatatacttggaggcctatgaagagtacaccagcaagttagatgctctt
caacaaagagaacagcagttattggaatccatggggaatggaactgatttctctgtctcc
agctctgcttcaacagacacagttacatcatcttcctcctctagcctctctgtagcacct
tcatctctttcggtttatcagaaccccacagatatgtcacggaataaccccaagtctcca
caaaaacctattgttagagtcttcctacccaacaaacagaggacagtggttccagcaaga
tgtggggtgacagtccgggacagtctaaagaaagctctgatgatgaggggtcttatccca
gaatgctgtgctgtttacagaatacaagatggagagaagaagcccattggctgggacact
gacatttcctggcttacaggagaggagttgcacgtggaagtcttggagaatgtgccgctt
accacacacaattttgtacgaaagacgttcttcactttagcattctgtgacttttgtcga
aagctgcttttccagggattccgatgccagacttgcggttataaatttcaccagcgctgt
agtacagaggtgccactgatgtgtgttaattatgaccagcttgatttgctgtttgtctcc
aagttctttgaacaccacccaatatcgcaggaggaggcctccttaggagagaccacccaa
gcatctggatcgtactcttcagtgcccccctcagattctattggaccaccaattctccct
agtccttctccttcaaaatccattccaatcccacagcccttccgaccagcagatgaagac
catcggaatcaatttgggcaacgagaccgctcgtcttcagcacccaatgtgcacatcaat
acaatagagcctgtcaatattgatgacttgattagagaccaggggttacgaggagaggga
gcccctttgaaccagctgatgcgctgtcttcggaaataccaatcccggactcccagtccc
ctcctacattctgtccccagtgaaatagtgtttgattttgagcctggcccagtgttcaga
ggttcaaccaccggtttgtctgccaccccacctgcctctttgcctgggtcccttaccagt
gtgaaagctttacagaagtcccctggaccacaacgagagaggaagtcatcctcatcctca
gaagacaggaatagaatgaaaacccttggtcgacgggactcaagtgatgattgggagata
ccagatgggcagattacagtcggacagaggataggatctggatcatttggaacagtctac
aagggaaagtggcatggtgacgtggccgtgaaaatgttgaatgttacagcacccacgcct
cagcaattacaggccttcaaaaatgaagtaggagtgctcaggaaaacacgacatgtgaat
atcctacttttcatgggttattcaacgaagccacagttggctattgttacacagtggtgt
gagggctccagtttgtatcaccatttgcatatcattgagaccaaatttgagatgatcaaa
ctcattgatattgcacggcagaccgcacaaggcatggattacttgcacgccaagtcaatc
atccacagagacctcaagagtaataatatatttcttcatgaagaccttactgtaaaaata
ggtgattttggtctagccacagtgaaatcacgatggagtgggtcccatcagtttgaacaa
ttgtctgggtccattctatggatggcaccagaagtaatcaggatgcaagataaaaaccct
tatagctttcaatcagatgtatatgcatttgggattgttctttatgagctgatgactggg
cagttaccatactcgaacatcaataacagggaccagatcatttttatggtgggacgagga
tacctgtctccagatctcagtaaagtgcgaagtaactgtccaaaagccatgaagaggcta
atggcagagtgcttgaagaagaaaagagatgagcgacccctctttccacagattcttgcc
tccattgagcttctggctcggtcattgccaaaaattcaccgcagtgcatctgagccctca
ttaaaccgggctggcttccagacggaggattttagtctgtatacttgtgcttctccaaaa
acacccatccaggcagggggatacggagaatttgcagcgttcaagtag

DBGET integrated database retrieval system