KEGG   Chelonia mydas (green sea turtle): 102938812
Entry
102938812         CDS       T02989                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04210  Apoptosis
cmy04620  Toll-like receptor signaling pathway
cmy04621  NOD-like receptor signaling pathway
cmy04622  RIG-I-like receptor signaling pathway
cmy04623  Cytosolic DNA-sensing pathway
cmy04625  C-type lectin receptor signaling pathway
cmy04920  Adipocytokine signaling pathway
cmy05132  Salmonella infection
cmy05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102938812 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102938812 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102938812 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102938812 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102938812 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102938812 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102938812 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102938812 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102938812 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102938812 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102938812 (IKBKG)
Protein kinases [BR:cmy01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102938812 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO Dishevelled HrpB7 DUF2205 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 102938812
NCBI-ProteinID: XP_007072436
LinkDB
Position
Un
AA seq 542 aa
MEPQEAIRQSNQMLRQRYQEFLRFQATQREEKEFLMLRFREARDVVEKLNTERTEMKCQL
EQALWEVEQLKGRQQVSGELPIPHTKGKGVLQGHSPRTLEKEIPEPEEADTMTLTQELAE
PPMTPGSETLQLLKEQLEQLQEANQTLQAQIQQQVQPPGEAGVRVKNGVQLERPVELEAL
QGSGDSGPSSRQGAAELLQRRLKETEEESVELKQQLALVREEVARLGARAQEAEQQAEQQ
LQALRKQLEQLTEDRASVKAQVTSLLGELQESQSRLEACMLEKQDLEEKAQAAAEQCCKL
EREAEALHKQHSVQVDQLRMQAQNLETALRVERQGATEEKRKLAQLQAAYHQIFQEYDGH
VKSSLESEKRSQGMELHLKELLQQLQQAEEALVAKQELIDKLKEDMEQHKAVLETIPVLK
AQADIYKADFLAEREAREKLHEQRETLQEQLEQLRRDYDKLKADANGATWALMEEMRNRH
SEGRPPVPQPVYNMAPVPFQALPAAGRRRSISEEQPDFCCPKCQYQAPDMDTLQIHVMDC
IK
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggaaccacaggaggccattcgacagagtaaccagatgctgcggcagcgctaccaggag
ttcctgcgcttccaggccacgcagcgcgaggagaaggagttcctgatgctccgtttccgg
gaggcccgggatgtggtggagaagctgaacactgagcggaccgagatgaagtgccaactg
gagcaggccctctgggaggtggagcagctcaagggaaggcagcaggtatcaggagagctt
cctatcccccacaccaaggggaaaggggttttgcaggggcattctccgcgcaccctggag
aaggagattcctgagccagaggaggcggacactatgaccctgacccaggagttggctgag
ccccccatgacccctggctcagagactctgcagctgctgaaggagcagctggagcagctc
caggaggccaaccagaccctgcaggcccagatccagcagcaggtgcagcccccaggagag
gctggtgtgagggtcaagaatggagtccagctggagaggccggtggagctggaggccctg
cagggcagcggggacagcggacccagcagcaggcagggcgcagccgagctgctgcagagg
cggctgaaggagacggaggaggagagcgtggagctgaagcagcagctggcattggtgcgg
gaggaggtggccaggctgggagccagggcgcaggaggctgagcagcaggccgagcagcag
cttcaggccctgaggaaacagctggagcagctgacggaggacagggcctcggtgaaagcc
caggtgacctcactgctgggggagctgcaggagagccagagccggctggaggcctgtatg
ctggagaaacaggatctggaggagaaagcacaggctgctgccgagcagtgctgcaagctg
gagcgggaggctgaggcgctgcacaagcagcacagcgtgcaggtggaccagctgcgcatg
caggcccagaatctggagacggcgctgcgggtggagaggcagggcgccacagaggagaag
aggaagctggcccaactgcaggcggcctatcaccagatctttcaggagtacgatgggcat
gtgaaatccagcctagagagcgagaagaggagccagggcatggagctgcacctgaaggag
ctgctgcagcagctgcagcaggccgaggaggcactggtggccaagcaggagctgattgac
aagctgaaggaggacatggagcagcacaaggctgtgctggagaccatcccggtgctgaag
gcccaggccgatatctacaaggcggatttcctagcggaacgtgaggcccgggagaagttg
cacgagcaacgcgaaactctgcaggagcagttggagcagttacggcgggactatgacaag
ctgaaggcagacgctaatggagccacctgggctctgatggaggagatgaggaaccgccat
tcggaggggcgcccgcctgtaccccagccagtttacaacatggccccagtacctttccaa
gccctgccagctgcagggcgtaggcgaagtatctccgaggagcagccggatttctgctgt
cccaagtgccagtaccaggctcctgacatggatacactgcagatccatgtgatggactgt
atcaagtga

DBGET integrated database retrieval system