KEGG   Chelonia mydas (green sea turtle): 102939145Help
Entry
102939145         CDS       T02989                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04020  Calcium signaling pathway
cmy04070  Phosphatidylinositol signaling system
cmy04114  Oocyte meiosis
cmy04210  Apoptosis
cmy04218  Cellular senescence
cmy04270  Vascular smooth muscle contraction
cmy04371  Apelin signaling pathway
cmy04540  Gap junction
cmy04621  NOD-like receptor signaling pathway
cmy04625  C-type lectin receptor signaling pathway
cmy04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102939145 (ITPR3)
   04020 Calcium signaling pathway
    102939145 (ITPR3)
   04070 Phosphatidylinositol signaling system
    102939145 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102939145 (ITPR3)
   04210 Apoptosis
    102939145 (ITPR3)
   04218 Cellular senescence
    102939145 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102939145 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102939145 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    102939145 (ITPR3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102939145 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102939145 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmy01009]
    102939145 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cmy04040]
    102939145 (ITPR3)
Protein phosphatases and associated proteins [BR:cmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102939145 (ITPR3)
Ion channels [BR:cmy04040]
 Ligand-gated channels
  IP3 receptor
   102939145 (ITPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RYDR_ITPR MIR Ins145_P3_rec RIH_assoc Ion_trans SopA DUF2207
Motif
Other DBs
NCBI-GeneID: 102939145
NCBI-ProteinID: XP_007063621
LinkDB All DBs
Position
Un
AA seq 2566 aa AA seqDB search
MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKDKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQVVVGDKVILNPVNAGQPLHASNYELADNAGCKEVNSVNCNTSWKINLFMQFRDHMEE
VLKGGDVVRLFHAEQEKFLTCDEYKAKIHVFLRTTLRQSATSATSSNALWEVEVVHHDPC
RGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDAADPKSAPMGGTIRSSRRKTGEKIKYR
LVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTDVPIDIDEERPI
RLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLANVVEKMNEGFISQNDRRFVI
QLLEDLVFFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFKEKGGEG
PLVRLEELSDQKNAPYQYMFRLCYRVLRHSQDDYRKNQEHIAKQFGMMQSQIGYDILAED
TITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELIC
KCVLDPKNSDILIKTELRPVKEMSQTHEYLSIEYSEEEVWLTWSDKNNDSQEKSIRQLAQ
EARAGNAHDENILSYYRYQLKLFARMCLDRQYLAIKEISKQLGVELIFLCMADEMLPFDL
RASFCHLMLHVHVDRDPQELVMPVKFARLWTEIPTAITIKDYDSNLNDSRDDKKNKFAST
MEFVEDYLNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIID
CVQNPQLMMQTMYNEDMAGKNVRKSIQGVGQMMSTMVLSRKQSIFSVPSLSTVVASEPTD
RERTIENENIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFIEVYPMQDSSADGT
APAFDSTNAAMNLDRIGEQAEAMFGVGKSSSMLEVDDEGGRMFLRVLIHLTMHNYPPLVS
GSLQLLFKHFSQRQEVLHTFKQVQLLISAQDVENYKVIKAELDKLRMMVEKSELWVDKKG
SPKGEDAGEGAKKEKKEHTADEEVSTPEEKSSENYKIVKGILERLNKMCGVGEQVRKKQQ
RLMKNMDAHKVMLDLLQIPYEKGDAKMMEILRYTHQFLQKFCAGNQGNQALLHKHLNLFL
TPGVREEAETMQHIFLNNYQLCSEISETVLQHFVHCLATHGRHVQYLDFLHSIIKAEGKY
VKKCQDMIMTELTNAGDDVVVFYNDKASLATMLEMMTAAREGVEENSPLMYHISLVDLLA
ACAEGKNVYTEIKCTSLLPLEDIVQVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYT
SNHIWTLFENFTLDMATMCKKREKRLTDPALEKYVLTVVLDTINAFFSSPFSENSTSLQT
HQTIVVQLLQSTMRLLECSWLQQQHKTSVEACIRTLAMVAKSRSIALPMDRRHRRLQDII
NSLEERFKPLVEAEVSVLVDVLHRPELLFMEGTDAYQRCESGGFLSKLVQHTKDLMESEE
KLCIRVLRTLQQMLMKRNKYGDRGNTLRKMLVSNYLQNKKSSSKGEIVDTTGGGQDQDWS
VIAAIQCRLDREGATKLVSDLIMNTKNEKIFQESILLAIRLLDGGNTEIQKSFYNLMTSD
KKCEKFFKVLHERMKKAQQETKSIVSVNMTDIGNKPQEDKDTPDPGTKGRGTFMLSHAPS
RHPMAIGFRKGHDTGERSQNNEMGMSILIMEPILRFLQLLCENHNRDLQNFLRCQNNKTN
YNLVCETLQFLDIMCGSTTGGLGLLGLYINECNVALITQTLETLTEYCQGPCHENQSCIV
THESNGIDIITALILNEISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAARILISL
RPQELVDVIKKAYLQEEECENSEISPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEE
EVEGISSMLRLKNKQLTQMLKSTAPIQEEEEDPLAYYEKHTSQIEIVRLDRSMEQIIFPV
PSICEFVTRETKYRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQKKLRSMPLMYWFSRR
MTLWGSISFNLAVFINIIIAFFYPYVEATSMGVLDSPLISLLFWLLICFSIMALFTRRYG
VRPLLVALILRSIYYLGIGLTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMIMDMEF
LYHVAYIVTSILGLFVHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILV
YLFSIVGFLFLKDDFIMEVDRLPDNKSKDGPLGMQRNMEAFMESCSGDKISCSAVPDVLR
DDDDNSERACDTLLMCIVTVLNHGLRNGGGVGDILRKPSKDESLFPARVIYDLLFFFIVI
IIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKYEHNM
WNYLYFIVLVRVKNKTDYTGPESYVAQMIKNMNLDWFPRMRAMSLVSNEGEGEQNEIRSL
QDKLNSTMKLVSHLTSQLNELKEQMTEQRKRRQRIGFVDAQNTMNH
NT seq 7701 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatgtccagcttcttgcacatcggggacatcgtctccctgtacgccgaaggg
tcggtcaatgggttcatcagcacgctggggctggtggatgatcggtgtgtggtggagccg
gcagctggcgatctggataatccacccaagaagttccgggactgtctcttcaaagtatgt
cccatgaaccgctactctgcccagaagcagtactggaaggccaagcaaaccaagcaggac
aaggacaagattgctgacgtggtactgctgcagaaactccagcatgcggcgcagatggag
cagaagcagaacgatacggagaataagaaggtgcacggggacgtggtgaagtacggcagc
gtcatccaggtagtcgtgggagacaaagtgatcctgaatcctgtgaacgccgggcagccg
ctgcacgccagcaactacgagctcgccgacaacgccggctgcaaagaggtgaactcggtc
aattgcaacaccagctggaaaatcaacctgttcatgcagttccgggaccacatggaggaa
gtgctgaaagggggggatgtggtgaggctgttccatgccgagcaggagaagtttctcacc
tgcgacgagtacaaggccaaaatccacgtcttcctccgcaccaccctgaggcagtctgcc
acatctgccaccagctccaatgcactgtgggaagttgaggtggtccatcacgatccctgc
cgaggcggagccgggcactggaacggcctgtaccgcttcaagcatctcgccactgggaac
tacctggccgcggaggaaaacccaagttacaaaggagatgccgccgatcccaagtctgca
cccatgggcgggaccattcgctccagccggaggaaaacgggggagaagatcaaataccgg
ctggtggccgtgccccacgggaatgacattgcctccctctttgagttggaccctaccacg
ctgcagaagacggattcctttgtccctcggaactcctacgtgaggctgcgccatctctgt
acgaacacttggatccagagcactgacgtgcccattgacatcgatgaagagagacccatt
cgtctcatgctcggcacctgccccaccaaggaggacaaagaagctttcgccattgtctct
gtgccagtgtcagaaatccgggacctggattttgccaacgatgccagctccatgctggcc
aacgtggtggagaagatgaacgagggcttcatcagccagaacgaccgcaggtttgtgatc
cagctgctggaggacctggtgtttttcgtcagcgacgttcccaacaacgggcagaatgtg
ttggacatcatggtgaccaaacccaaccgggagaggcagaaactcatgcgggagcagaac
atcctgaaacagatcttcgggatcctgaaagctcccttcaaggaaaagggaggggaaggc
cccctggtgcggctggaggagctgtcggatcagaagaacgctccctatcagtacatgttc
cgcctctgctaccgggtgctgcggcactcccaggatgactatcgcaagaaccaggaacat
atcgccaagcagttcggcatgatgcagtcccagatcggctacgacatcctggcagaggac
accatcaccgccctcctgcacaacaaccgcaagctgctggagaagcacatcaccaagacc
gaggtggagaccttcgtcagcctggtgcgcaagaaccgggaacccaggttcttagattac
ctctcggacctgtgtgtgtccaaccacatcgccatccccgtcacccaggagctgatctgc
aagtgtgtgctggaccccaagaacagcgacatcctgattaaaacggagctaaggccagta
aaggagatgtcccagacccacgaatacctgagcatcgagtactccgaggaggaggtctgg
ctgacctggagtgacaagaacaacgactcccaagagaaaagcatccggcagctggcgcag
gaggcgcgggcgggcaacgctcatgatgagaacatcctgagttactacaggtaccagctg
aagctgtttgcccgcatgtgcctggaccgccagtacctggcgatcaaagagatctccaag
cagctgggggtggaactcatcttcctctgcatggcggacgagatgctgccctttgacctc
cgggcctccttctgccacctcatgctgcacgtgcacgtagaccgggacccccaggagctg
gtgatgcccgtcaagtttgcgcggctgtggacggagatccccaccgccatcaccatcaaa
gactacgactccaatctgaacgactcccgggacgacaagaagaacaagttcgccagcacc
atggagttcgtggaggattatctcaacaacgtggtgagcgaggcggtgcccttcgccaac
gaggagaagaacaagctcacctttgaggtcgtcagtctcgcccacaacctcatctacttt
ggcttctacagcttcagtgagctgctacgcctgacacgcactctgctgggtatcatagac
tgtgtccagaaccctcagctcatgatgcagaccatgtacaatgaagatatggcggggaag
aacgtgcggaagtccatccagggtgttggccagatgatgtccaccatggtcctgagccgg
aaacagtccatcttcagtgtcccaagcctcagcactgtggtggcctctgagcccacggac
cgggagaggaccatagagaatgaaaacattgttgtgatggagaccaagctgaagatcttg
gagatcttgcagttcatcctgaacgtgcggttggactacaggatctcctacctgctctcc
gtcttcaagaaggagttcatagaagtctaccccatgcaggacagcagcgcggatgggaca
gctccagccttcgactccacaaatgcagcgatgaacttggacagaataggggagcaggca
gaggccatgttcggggtcgggaagtcaagcagcatgttagaggtggatgatgaaggaggg
aggatgtttctccgtgtgctgatccacctgacgatgcacaactatcccccgcttgtctcc
ggctccctccagctcctcttcaaacactttagccagaggcaggaggtgctgcacaccttt
aaacaggtccagctcctgatctcggctcaggatgttgagaattacaaggtgataaaggct
gagctcgacaagctgcgcatgatggtggagaaatctgaactctgggtggacaagaagggc
agccccaagggggaggacgcaggggaaggggccaagaaggagaagaaagagcacactgca
gatgaggaggtcagtacccctgaagagaagagcagcgagaattacaagatagtcaaaggg
atcctggagcggctcaataaaatgtgtggggtgggtgagcaggtgcgcaagaagcagcag
cgcctgatgaagaacatggacgcccacaaagtgatgctggatctgctgcagatcccctat
gagaagggtgatgcaaagatgatggagattctgagatacacccaccagttcctacagaaa
ttctgcgctgggaaccaaggaaaccaggcccttctgcacaaacatctcaacttgttcctc
acccctggggtaagagaggaggccgagacgatgcagcacatcttcctgaacaactaccag
ctgtgctcggagattagcgagacagtgcttcagcacttcgtccactgcctggccacgcat
ggccgccacgtgcagtatctcgacttcctgcacagcatcatcaaggcggagggcaagtac
gtcaagaagtgccaggacatgatcatgacggagctcaccaatgccggggacgacgtggtg
gtcttctacaatgacaaggcctcgcttgccaccatgctggagatgatgacagcggcccgg
gaaggggtggaggagaacagccccctcatgtaccacatctccttggtggacctgctggct
gcctgtgccgagggcaagaacgtctacacggagatcaagtgcacatccctgctgccgctg
gaggacattgtgcaggtggtgacgcacgaggactgcatcaccgaggtgaagatggcctac
gtgaacttcgtcaaccactgctacgtggacaccgaggtggaaatgaaggagatctacacc
agcaaccacatctggactctcttcgagaacttcaccctggacatggccacgatgtgtaag
aagcgagagaagcgtctgacggaccccgccctggagaagtacgtgctcaccgtggtgctg
gacaccatcaatgccttcttcagctcccccttctcggagaacagcacttccctgcagacc
caccagaccattgtcgtgcagctcctccagtccaccatgaggctcctggagtgctcctgg
ctacagcagcagcacaagacctcggtggaggcctgtatccgtaccctggccatggttgcc
aagagccgctccatcgccctgcccatggaccgacggcatcgtcgtttgcaggacatcatc
aactccctggaggaacggttcaaacccctggtggaagccgaagtgtctgtcctggtggac
gttctgcaccgcccagagctgctcttcatggaggggaccgatgcctaccagcgctgcgag
agcgggggcttcctctccaagctggtccagcacactaaggacctgatggagagcgaggag
aagttgtgcatccgggtcctgaggacgctgcagcagatgctcatgaagaggaacaaatat
ggggacaggggcaacacgctgaggaaaatgcttgtgagtaactacctgcagaacaagaag
tcgagctccaaaggggagatcgtcgacacgactgggggtggccaagaccaggactggtca
gtcattgctgccatccagtgccggctggacagagaaggggccaccaagctggtgtcggac
cttatcatgaacaccaaaaacgagaagattttccaggagagcatcctcttagccatccgg
ctgctggacggcggcaacacggagatacagaaatcgttttataacctgatgacaagcgac
aagaagtgtgagaagttctttaaagtgttgcatgaacgcatgaagaaggcgcagcaggag
accaagtccatagtgtcggtgaacatgactgacattgggaacaagccccaggaggacaaa
gacacccctgaccctggcactaagggacgaggaaccttcatgctgtcccacgccccatct
cggcaccccatggccattgggtttcgaaagggccacgacactggggagcgaagccagaac
aatgagatgggaatgtcgatcttgatcatggagcctattcttcggttcctgcagttgctg
tgtgaaaaccacaaccgggatctccagaacttcctccggtgccagaacaataagaccaac
tacaacctggtgtgtgagacgctgcagttcctggacatcatgtgtggcagcaccacgggg
gggctgggcctgctgggcctctacatcaacgaatgcaacgtggcccttatcacccaaacc
ctggagaccttgacggagtattgccagggaccatgccatgagaaccagagctgcattgtg
acgcacgaatctaatggcattgacatcatcacggccctgatcctgaatgagatcagcccc
ctctgcaagtacagaatggaccttgtcctccagctgaaggacaatgcctccaaactcctg
ctggccctgatggagagcagacacgacagtgagaatgccgcgcggatcctcatcagcctt
cggcctcaggaactggttgacgtaattaaaaaagcctatctccaggaggaagagtgcgag
aactctgagatttccccccgggaagtcgggcacaacatctatatcttggccttacagctg
tctcggcacaacaagcaactgcagcatctgctgaaaccggtgaagcgaatccaggaggag
gaggtggagggcatctcctctatgctccgcttaaaaaataagcagctgactcagatgctg
aaatcaacggctcccatccaggaggaggaagaagacccgctggcgtattacgagaagcac
acctcccagattgagattgtgcgcctggaccggagcatggagcagatcatcttccccgtg
cccagcatctgcgaattcgtcaccagggagaccaagtaccggctgttcaccaccacggaa
caagacgagcagggcagcaaagtcagcgacttcttcgaccagtcgtccttcctccacaac
gagatggaatggcagaagaaactgcgcagcatgccactgatgtactggttctcccgcaga
atgactctctggggaagcatttccttcaacctggctgtcttcatcaacatcatcattgct
ttcttctacccctacgtcgaagccacctctatgggagtgttggattccccattgatctcc
ctgctcttctggcttctgatctgcttctccatcatggccctgtttacccgtcgctacggc
gtcagaccgctcctcgtggcattgatcctgcgatcgatctattatttagggattgggctc
acgctgaacatcctgggagctctcaatctgaccaacaagattgtgttcgtggtgagcttt
gtgggcaaccgtgggacatttatccggggctacaaagccatgatcatggatatggagttt
ctctaccatgtggcctacattgtgaccagcattctggggctctttgtacatgaactcttc
tacagcatcttgctctttgacttgatctaccgtgaggagaccttgttcaacgtcatcaaa
agcgtgacacggaacggacgctccatcctgctgaccgccctcctggctctcatcctcgtc
tacctcttctccattgtgggtttcctcttcctgaaagacgacttcatcatggaggtggat
cggctgcctgacaacaagtccaaagacggccctttggggatgcaaaggaacatggaggct
tttatggagtcgtgcagtggtgacaaaattagctgctctgcagtgcctgatgtgctgaga
gatgatgatgataactcagagcgtgcctgcgacacgctgctcatgtgcattgtcactgtc
ctgaatcacggcctgaggaacggagggggcgtgggtgacattctcaggaagccatccaag
gatgagtccttgttccctgctcgggttatctacgacctcctcttcttcttcattgtcatc
atcattgtcctcaaccttatctttggtgtcatcatagacacctttgctgatctgaggagt
gagaagcaaaagaaggaagaaattcttaagaccacatgtttcatatgtggtctcgaaagg
gacaagtttgataataagactgtgtccttcgaggagcacattaaatatgagcacaacatg
tggaactatttgtacttcatcgtgctggtgcgagtaaagaataagactgactacacaggg
cccgagagttatgtggcacaaatgattaagaacatgaacctggactggttccctcggatg
cgagccatgtcgttggtcagcaatgaaggggaaggggaacagaacgagatccggagtctt
caagacaagctcaactccactatgaagctggtgtctcacctcacttcacagctgaatgag
ctgaaagagcagatgacagagcaaaggaagcgcagacagcgcatcggttttgtggatgcc
cagaacaccatgaatcactga

DBGET integrated database retrieval system