KEGG   Chelonia mydas (green sea turtle): 102939663Help
Entry
102939663         CDS       T02989                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102939663 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cmy03012]
    102939663 (EIF3A)
Translation factors [BR:cmy03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102939663 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 102939663
NCBI-ProteinID: XP_007064281
LinkDB All DBs
Position
Un
AA seq 1392 aa AA seqDB search
MPVYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLSNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYHKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRISLINDMVRFNVVQHVVPEVKELYNWLEVDFHPLKLCDRVTKVLNWVRDQVEK
EPELQLYVPHLQNNTILRLLQQVAQIYQTIDFSRLTTLVPFVDAFQLERAIVDAARHCDL
QVRLDHTSRTLSFGSDLNYSTREDAPLGPQLQSMPSEQIRNQLTAMSSALAKALEVIKPP
NIVQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKTAYEEQRIR
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDKDLFVSRLMAARQSVYQEKLKQFE
ERLAEERHNRLEERKRQRKEERRISYYREKEEEEQRLQEEKMLKELEEKERIEREKREQE
QREYQERVRKLEEVERKKRQRELEIEERERRREEERRGLDDPLSRRESRWGDRDSDSTWR
RTAEPESEWRRAPPEREWRRGEGRDDERPFRRGDDLLRRGGAEEKEPSSQEANEDRAPKR
DVDKDGEPRRDEDGEPKRGVNGEPRRGVDEDGEPRQEEDREPRQGVDQDRGSWRTADADR
GPRRGLDEDRGPRRGLDEDRGPRRGLDEDRGPRRGADADRGPRRGLDDDRGPRRGLDDDR
ISRRXGPSGGEDDRGGRRRTDDDRGPRRGLDDDRGPRRGLDDDRGSWRIADDDRGPRRGL
DDDRISRRDEDRGPWRSADEDRLSRRDDDRGPWRGGDDDRGPRRGDDSRPGPWRPFGKPG
GWREREKAREDSWGPPRDSRPSEDCELDRDKDCDENEKDREIDKERDLDRDDRFRRPRDE
APWRRGPAEEASSWRDSNRRDEWDRGGRDMRDRRGDDRDRRGLPIRTDREETSSWRRGDE
RKEERGEEHETTRRAAPAPTPVPAAAPPPPISKDRERDAESEKGSWRTEKERESLRRTKN
ETDEDGWTTVRR
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgtatttccagcggcccgagaatgccctgaagcgggcgaacgaatttcttgag
gttggcaagaaacaacctgccctcgatgttctttatgatgttatgaaaagcaaaaaacat
cgaacatggcaaaaaatccacgagccaattatgctgaagtatctggagctctgcgtggac
ctccgcaagagccacctggcaaaagaaggattgtatcagtacaagaacatttgccagcag
gtgaacatcaaatccttggaggatgttgttcgagcctatttgaaactagctgaagaaaaa
actgaagctgccaaggaagagtcccagcagatggtgctagacatagaagacttggataat
attcaaactccagagagtgttctcctaagtgctgtaagtggggaagacactcaagatcgc
acagatcggctgcttttaactccctgggttaaatttctatgggagtcatacagacagtgt
ttggaccttcttcgaaacaattctagggtggaacgcctctaccatgatattgcacagcaa
gcttttaagttctgcttgcagtacactcgtaaggctgagttccgtaaactctgcgataac
ctgaggatgcatttagggcagatccaacgccaccataaccaaagtacagcaattaacctc
agtaatcctgagagccagtctatgcacttggagacaaggcttgtacagctggacagtgct
attagcatggaattgtggcaggaagctttcaaagcagtggaggatattcatgggctattc
tccttgtctaagaaaccacccaaaccccagctgatggcaaattactatcacaaagtttcc
actgtcttttggaaatcaggaaatgctcttttccatgcatccacacttcaccgactgtac
cacctgtcaagagaaatgcgaaagaatctcacacaagaggagatgcagaggatgtcaacc
cgagtccttttggctactctgtcaattcctataactcctgagcgaactgatattgctcgt
cttctggatatggatggtatcatcgttgaaaagcagcgacgtctagccacgctgctgggc
ctccaggccccacctacacgtatcagtcttattaatgacatggtgaggtttaatgtagtg
cagcatgttgttccagaggtaaaggaactttacaattggcttgaagtagatttccaccca
ctaaagctatgtgatcgtgtaaccaaggttctaaactgggtgagagatcaagttgaaaag
gaacctgaattgcagctgtatgtcccacatctgcaaaacaacaccatccttcgtcttctg
cagcaggtggcgcagatttatcagaccatcgacttttctcgtttaactaccttggttcct
tttgttgatgctttccaattagagcgtgctattgtcgatgcagccagacattgtgacttg
caagttcgccttgatcatacttctcgaacgctgagcttcggatcagatttaaattattca
actcgggaagatgcaccgcttggccctcagctgcaaagtatgccttctgagcaaataaga
aatcagctgactgctatgtcctctgctcttgctaaggctcttgaagtgattaaaccacca
aacatagtgcaagagaaggaagaacaacatcagttggctgtcactgcttacttaaaaaat
tcaaggaaagagcatcagcgtatccttgctcgtcgtcaaacaatagaggagagaaaggag
cgtcttgaaagtctaaacattcagcgtgagaaagaagagttggaacagcgtgaagccgaa
cttcaaaaagttcgtaaagctgaagaagagagactgcgccaggaggcaaaagagagagag
aaggagcgtattctgcaagaacatgagcaaatcaaaaaaaaaactgttcgtgaacgtttg
gagcagattaagaagactgaactgggagccaaggcattcaaagatattgatattgaggat
cttgaagaattggaccctgacttcatcatggctaaacaggttgaacagctggagaaggaa
aagaaggaactccaagaacgtctgaagaatcaggaaaagaagattgactattttgaaaga
gcaaagcgcttggaagaaattcctctgataaagactgcttatgaggaacaaagaatccga
gacatggacctgtgggaacagcaagaagaagaaaggatcaccacaatgcagctggaacgc
gaaaaagcgttggagcataagaacaggatgtcaaggatgttggaggataaagacttattt
gtatctaggctcatggcagcacgacaatcagtttatcaggaaaaactcaaacagttcgaa
gaaaggttagcagaagaaagacataatcgtttggaggaacgcaagagacaacgcaaagag
gagaggcgtatttcttattacagagaaaaggaggaggaagagcagagattgcaagaagaa
aaaatgcttaaagagcttgaggagaaggaacgtattgagcgtgaaaaacgtgagcaggaa
cagcgggaataccaggagcgtgtcagaaaactagaagaagtagagaggaaaaaacgtcaa
agagagctggaaattgaagagagggagcgacgcagagaagaggagaggaggggtcttgat
gacccactttcaagaagggaatcacgttggggtgacagagattctgacagcacctggaga
cgaaccgctgaaccagaatcagaatggagacgagcaccaccagagagggaatggcgccgt
ggagaagggcgtgatgatgaaagacctttccgaagaggagatgatctacttagacgtggt
ggtgctgaagagaaagagccttcttcccaggaagcaaatgaagacagagcccccaagcgg
gatgtggacaaggacggggaacccaggcgggacgaggacggggaacccaagcggggcgtg
aacggggaacccagacggggtgtggacgaggacggggaacccaggcaggaggaggacagg
gaacccaggcagggtgtggatcaggacagagggagttggcgcactgcagatgcggacagg
gggcccaggcgcgggctggatgaggacagggggcccaggcgcgggctggatgaggacagg
gggcccaggcgcgggctggatgaggacagggggcccaggcgcggggcggatgcagacaga
ggacctaggcggggcctggatgacgacagggggccgaggcggggcctggatgacgacaga
atttccagacgatgaggacccagcggcggggaggatgacagggggggaaggcggcgcact
gatgacgacagaggacccaggcggggcctggatgacgacaggggacccaggcggggcctg
gatgacgacagggggagttggcgcattgcagatgacgacagggggccgaggcggggcctg
gatgacgacagaatttccagacgagatgaggacagaggcccctggcgtagtgcagatgag
gatcgactctcaagacgtgatgatgacaggggtccatggcgtggtggggatgatgacaga
gggcccaggcgtggtgatgattcaagacctggtccttggagaccatttggtaaaccaggc
ggatggagagaacgagagaaagctcgtgaagacagctggggacccccgcgagactccaga
ccttcagaagactgtgaattggatagagataaagattgtgatgagaacgaaaaggatcgt
gagattgacaaagaacgtgaccttgatcgggatgatcgcttcagacgtccaagggatgag
gctccctggagaagaggaccagctgaggaagcttccagctggagagattcaaatcgtcga
gatgaatgggacagaggtggtcgtgacatgagagatcggcgtggtgatgatagagataga
agaggacttccgatccgaacagaccgtgaagaaacgagttcatggcggcgtggtgatgag
agaaaagaagaacgtggggaagaacatgaaactacccggcgagctgctccagctcctact
cctgttcctgctgctgctcctcctcctcctatttcaaaagatagggagagagatgcagag
agcgagaaggggtcctggagaactgaaaaagaacgagaatctcttcgtcgcactaaaaat
gaaacagatgaagatggatggaccactgtacgacgttaa

DBGET integrated database retrieval system