KEGG   Chelonia mydas (green sea turtle): 102939737
Entry
102939737         CDS       T02989                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04012  ErbB signaling pathway
cmy04068  FoxO signaling pathway
cmy04110  Cell cycle
cmy04115  p53 signaling pathway
cmy04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102939737 (CDKN1A)
   04068 FoxO signaling pathway
    102939737 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102939737 (CDKN1A)
   04115 p53 signaling pathway
    102939737 (CDKN1A)
   04218 Cellular senescence
    102939737 (CDKN1A)
SSDB
Motif
Pfam: CDI TetR_C_8
Other DBs
NCBI-GeneID: 102939737
NCBI-ProteinID: XP_007063538
LinkDB
Position
Un
AA seq 155 aa
MPLSQSNMHQAPCNRKICRNLFGPVDHEQLQNDLQDLMRRHLEEAQHRWNFDFETETPLE
GKLKWERVLYPDMSPACLPSQDPSHSKGNGGEKNQSSPARKISTKDLNVALSSEAVQTGS
ESRKTSPPRHLKRKQTSIKDFYSSKRRIVPCKPNP
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcctctgtcacagagtaacatgcatcaggccccctgcaacaggaagatctgccgaaac
ctctttggcccggtggatcatgagcagctccagaatgacttacaggacttgatgaggaga
catctggaagaagctcaacacaggtggaattttgactttgagacggaaacaccgctggaa
ggcaagctcaagtgggagagagtcctctatcctgacatgtctcctgcttgcctgccttct
caggacccaagccactccaaagggaatggtggagagaagaaccagagctctccagcacgt
aagatttctacaaaggatcttaacgtggccctctcaagtgaagcagtacagacgggctct
gagtcccgcaagaccagccccccacggcacctgaaacgcaagcagaccagcataaaagat
ttctacagttcgaagcggaggattgtcccttgcaagccaaatccgtga

DBGET integrated database retrieval system