KEGG   Chelonia mydas (green sea turtle): 102939834Help
Entry
102939834         CDS       T02989                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04210  Apoptosis
cmy04625  C-type lectin receptor signaling pathway
cmy04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102939834 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102939834 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102939834 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102939834 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102939834 (MAP3K14)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102939834 (MAP3K14)
Protein kinases [BR:cmy01001]
 Serine/threonine kinases: STE group
  Other
   102939834 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 102939834
NCBI-ProteinID: XP_007053884
LinkDB All DBs
Position
Un
AA seq 943 aa AA seqDB search
MAVMEIACQGAPDPTIGHQKELSANKGLSETVSEKQSSVCKVEDSEKVAFHSQWKILKDV
ITKGTAKEETEGGSASISIIAQAECENSQEFSPTFSERPFIADSKRYSRSDSLDQIPNNV
AHATEGKMAPAFWRSRHHGKGRKKRRKKRSKVRIQTLASAKQGPRTPEQESCTPIPVQED
ETHQNTLFSNSSCFSEPCKDSICDQIPFEKPRKVLLAGKLHSLRNLHRPELHKLISPVQC
LNHVWKLHCQGDFVPQPETLHPFPYNRLPPCFPVLDSPLCAMKHNPLETYLLDDRACANG
ERHLSGLSLEHSFPKCVSQSMETNLDKLSVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDLKEPFRETDDNEGVLLTEKLKPVDYEYREEVHWTKCHDSLGVGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAGVTSPKVVPLYGAVKEGPWVTIFMELMEGGSLGQLIKQ
SGYLPEDRALHYLGQALEGLEYLHAHHILHGDVKADNVLLSSDGSRALLCDFGHSARLHP
DGLGKCLVTGCYMPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTRYYNHP
LCLKIVKEPPPLREIPPSCNRSTVEIIKAGLEKEPLKRASAAELKTKADIALQEVGDVKN
PWKEYREPRHLSFDEKNNLHASLSPTVSLISETLASPGSAFKAPCLSQSLQPPSLELTEK
TEVTPWNLCKELPRICDPLSPSSLAPVPTKSSSSSERATTISEQELQQLEIELFLNSLSQ
PYSLEEQEQMLSCLSIDSPLMSDASEKNSLKASQSLRDTMSSGVHSWNSQTDGQSFSWNN
LLYRSRHTDTPSYFNGVKIQIQLLSGENLHIREFHRTKVGDIATGISRQIPASAFSLVTK
EGQPVRYDMEVPDSGIELQCTLAPDCSFGWTWRVKHGQLENRP
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgatggaaattgcatgccaaggagctcctgaccccaccatcgggcaccagaag
gagctttctgctaataaaggactgagtgaaacagtgagtgagaagcagagcagtgtttgc
aaagtagaagattcagagaaagttgccttccacagtcaatggaagatcctgaaagatgtg
atcaccaaaggaacagcaaaagaagagacagaagggggttctgcatccatttctatcatc
gcccaggctgaatgtgagaacagccaggagttcagccccaccttttcagaaaggcctttc
atagctgatagtaaacgttacagccggtcagacagtcttgatcaaatccccaacaatgtg
gcccatgctacagaagggaaaatggcaccagccttctggaggtcaaggcatcatggtaaa
ggcaggaagaaacgtcgcaagaaaagatccaaggtcagaatacaaacactggcctctgct
aagcaagggcccagaactccagaacaggaaagttgtacaccgatcccagtccaggaggat
gaaactcaccaaaacacactcttcagtaacagctcctgtttttcagaaccttgcaaggac
tcaatttgtgatcagataccatttgagaaacctagaaaagttctgctcgcaggcaaactc
cattcgctaaggaacctgcacagaccagaactgcacaagttgataagcccagtacagtgc
ctgaaccatgtttggaagctacactgtcagggtgactttgtgcctcagccagagaccctc
catcccttcccttacaacagattgcccccttgcttccccgttctggacagtcctctttgt
gccatgaaacacaatcctctggagacttatctccttgatgatcgggcctgtgcgaatggt
gagcgtcacttgtctggcctaagcttagaacacagcttcccaaaatgtgtcagccagtcc
atggaaaccaacttggacaaactttctgtggaagaatatttggtggatgctcttaagggg
agtgtgagtctcggtgagccgcagaatttagccagcctggccaagacgtggagaggaggt
ggtctggatttgaaggagccatttcgagagacagatgacaatgagggggtgctgcttact
gagaaactaaagccggtggactatgaataccgagaagaggttcactggaccaagtgccat
gactctctgggcgttggctcttttggggaagtgtacaaaatagaggacaaacagactgga
tttcagtgtgctgccaaaaaggtgcaagtcgaacactttcgtgcagaggagttgacgaca
tgtgctggagtgacaagtcccaaagttgtccctttgtatggagccgtgaaggaaggtcct
tgggttactatcttcatggagctaatggagggtggctcactaggccagctgattaaacaa
agtggctacttgccagaggatagagccctccattacctgggtcaagcattagagggtctg
gagtatcttcatgctcaccacattctgcatggagatgtcaaagcggacaacgtgctttta
tccagtgatggaagccgggctctcctctgtgacttcggccactctgctcgccttcatccc
gatggcttggggaagtgcttggtgacaggatgctacatgcctggcacagagacgcacatg
gctccagaggtagtaatgggaaaacgctgtgactcaaaggtggatgtctggagcagctgc
tgcatgatgctgcacatgctcaatgggtgtcatccttggacccggtattacaaccaccct
ctttgcttaaagatagtcaaagagccacctcctttgagggaaatcccaccttcctgtaac
cgttccactgtcgagatcattaaagccgggctagagaaggagccacttaaaagagcttct
gcagctgagttgaagactaaggctgacatagctctgcaggaggtgggagatgtgaagaac
ccctggaaagaatacagagaacctagacacttatcttttgatgaaaaaaacaatctgcat
gcctccctgtccccaacagtcagcctgatttctgagactttggctagccctgggtccgca
ttcaaagctccttgcctatcccaaagcctgcagccaccatctctggagctgacagagaag
actgaggtaaccccttggaatctgtgcaaggagttacctaggatctgtgatccactctcc
ccctcctccctggctcctgtccccaccaagagcagcagctcctcagaacgggcaacaact
atctcggaacaggagcttcagcagctggaaatagagttgtttttgaacagcctgtcgcag
ccgtactctctggaggagcaggagcaaatgctctcgtgtctcagcattgacagcccgctc
atgtctgatgccagcgagaagaactctctgaaggcctctcagagcctgagggacacaatg
agctctggggttcactcctggaacagtcagaccgatggacagagcttcagctggaacaac
ctgctgtatcgcagtcggcacacagacacccccagctattttaatggagtgaaaatccag
atccagttgctaagtggagaaaatcttcatatccgagagttccacaggaccaaggtgggg
gacattgctactgggataagccgccagataccggcctctgctttcagccttgttacaaag
gaaggtcaacctgttcgctatgacatggaggttcctgactctggtatagaactgcagtgc
acccttgctcctgactgcagtttcggttggacctggagagtcaagcatggtcagctggag
aatagaccataa

DBGET integrated database retrieval system