KEGG   Chelonia mydas (green sea turtle): 102939927Help
Entry
102939927         CDS       T02989                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00052  Galactose metabolism
cmy00500  Starch and sucrose metabolism
cmy01100  Metabolic pathways
cmy04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102939927 (GAA)
   00500 Starch and sucrose metabolism
    102939927 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102939927 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmy04147]
    102939927 (GAA)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102939927 (GAA)
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102939927 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 GHL15
Motif
Other DBs
NCBI-GeneID: 102939927
NCBI-ProteinID: XP_007056107
LinkDB All DBs
Position
Un
AA seq 949 aa AA seqDB search
MPPVRLKEAENFPACKKASCAVLQMSVISIAALLTTVALHIIFSVHEVTVAAVSRRDPPG
PETTYKSSSANGEGRTWYQRWAGQLETPGAAASGPLHCDISPDSRFDCAPEKLLSRAECE
ARGCCYVPVSIKGSAIWQPWCFFPPSYPSYKMENLSATETGYAASLTRTVPSFFPEDLMV
LRLDVVFETEGRLHFTLRDPANKRYEVPLETPKARGQIASKLYSVQFSADPFGLMVFRES
SGQVLLNTTVAPLFFADQFLQISTSLPSRFISGLGEHLTSLALNINWTKVTLWNRDMAPT
PYVNLYGSHPFYLVMEDGGLAHGVFLLXXXLADVVLQPSPALTWRTTGGILDFYVFLGPD
PKSVVRQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAATRQAVKNMTAARFPLDVQWNDLD
YTDAKRDFTFNKNNFKDYPDMVREFHQSGRRYVMIVDPAISSSGPPGSYKPYDDGLKRGV
FIRNATGQPLVGKVWPGPTVFPDFTNPETQQWWHDMVKEFHDQVPFDGMWIDMNEPSNFV
AGSLDGCPNNKLENPPYVPGVMGGTLQAGTICASSQQYLSSHYNLHSLYGLTEAIASHRA
LVRVRGKRPFVISRSTFAGHGRFAGHWTGDVLSSWEQLYYSIPEVLLFNLYGVPLVGADI
CGFLGDTSEELCVRWTQLGAFYPFMRNHNDRGNKPQEPYAFSPAAQEAMRKALFLRYSLL
PYLYTLFHKAHSAGETVARPLFLEFPTDPNTLSVDHQFMWGAGLLITPVLEAGKTKVSGY
FPVETWYNLMAGSVIHSKGQWVLLPAPLDTINVHVRAGHILPLQEPGFTTTESRKKGMTL
VVALTVAGVARGDLFWDDGESLLTFEKGDYTQILFLAMNGVLLSELVRVNSQVDGLLLQE
VTVLGVPSPPQRVLANGVPVSNFSYHADTKILSIPLSLPLGEQFMVIWS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgcccccagtgagactgaaggaggctgagaattttcccgcctgcaagaaggcttcctgc
gccgtgctgcagatgtctgtcatcagcattgctgctctgctcacaacagttgccctacac
atcatattcagtgtccatgaagtcactgtggctgctgtgagccgcagagaccccccaggg
ccagagactacctacaaatccagtagtgctaatggagaagggcggacatggtatcagagg
tgggcagggcaactggagaccccaggcgctgctgcatcagggcccttgcactgtgacatc
tctccagatagccggtttgactgtgcacctgagaagcttctctccagagcagagtgtgag
gctcgtggctgctgctacgttccggtttccattaagggctctgcgatttggcagccctgg
tgtttcttcccgcccagctaccccagttacaagatggagaacctgagtgccacagagaca
ggctacgctgccagcctgacccgtaccgttccctcattcttcccagaagacctaatggtt
ctgcggctggatgtggtgtttgagacagagggcaggctccacttcacgctcagggatcca
gcaaacaaacgctatgaagtgccacttgaaacccccaaagcaagaggccaaatcgcctcc
aaactgtacagtgtgcagttctcagctgatccctttggcctgatggtcttcagggaatcc
agcgggcaggttctgttgaacaccaccgttgctcccctcttctttgctgaccagttcctc
cagatctccacctccctgccatcccgtttcatctctggcttgggggagcacctgacctca
ctcgccctcaacatcaattggaccaaagtcaccctttggaatcgggacatggcgcccacg
ccgtacgtcaatctctatggctctcacccgttctacctggtgatggaggatggcggcttg
gcccatggagtcttcctgctgnnnnnnngccttgcagacgtggtgctgcagccgagccca
gccctgacttggagaacaacaggcggcattctggatttctacgtcttcctgggccctgac
cccaagagtgtggtccggcagtacctggatgtcgtcgggtacccgttcatgcccccctac
tggggcctgggattccacttgtgccgctggggctactcctccaccgctgcaacccggcag
gctgtgaagaacatgacagcagcccggttccccttggatgtgcaatggaatgacctagat
tatacagatgccaagagagacttcaccttcaacaagaacaactttaaggactatccagac
atggtgcgggagttccaccaaagcggccggagatacgtcatgatcgtggatccagcaatc
agcagctctgggccccccggcagctacaaaccctacgatgacgggctgaagcgaggggtg
ttcatccgaaatgcaacggggcagcctctggttgggaaagtatggcctggcccgaccgtc
ttcccagacttcactaacccagagactcagcagtggtggcatgacatggtgaaggagttc
cacgaccaggtgcccttcgacggcatgtggattgacatgaacgagccatccaactttgtg
gcgggctccttggacggctgcccaaacaacaaactggaaaacccaccctatgtgccaggt
gtcatgggaggcaccctgcaggcagggaccatctgtgcctccagccagcagtacctgtcc
tcacactacaacctccatagtctgtacgggctgaccgaggccatagcttcccaccgtgcg
ctggtgagggtgcgagggaagcgccctttcgtgatctcgcgttcaacctttgcgggtcac
ggccgcttcgctggccactggactggggatgtcctgagcagctgggagcagctgtattac
tctatcccagaggtgctgctcttcaacctgtatggggtgccgctggtcggggcggacatc
tgcggctttctgggtgacacctctgaggagctgtgcgtacgctggacccagctgggtgcc
ttctaccccttcatgcggaaccacaacgaccgcggcaacaagccccaggagccgtacgcc
ttcagccctgcagcccaggaggccatgaggaaggccctcttcctgcgatactcgctgctg
ccgtatctctacaccctcttccacaaagcccactctgcaggggagacagtagcacgaccc
ctcttcctggagtttcccacagacccgaacaccctgagtgttgaccaccagttcatgtgg
ggagcggggctcctcatcacgccagtgctagaggcagggaagaccaaagtcagcggctac
ttccccgtagagacttggtataacctgatggcaggctccgtcatccacagcaagggccag
tgggtcctcttaccagctccactggacactattaatgtccatgtgcgggcaggacacatc
ctacctctgcaagagcctggcttcacgaccacagagagccgaaagaagggcatgaccctg
gtagtggccctgacagtggctggggttgccagaggcgacctgttctgggatgatggtgag
agcctgctgacatttgagaagggcgactacactcaaatcctcttcctggccatgaacggt
gtgctgctgagtgagctggtgcgggtgaacagccaggtggacgggctgttgctgcaggag
gtgacagtgctgggtgtccccagcccgccccagagggttctagctaacggcgtccctgtc
tccaatttctcctaccacgcggacaccaagatcctgagtatcccgctctctctcccactg
ggggagcagttcatggtcatctggtcctga

DBGET integrated database retrieval system