KEGG   Chelonia mydas (green sea turtle): 102940198
Entry
102940198         CDS       T02989                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04020  Calcium signaling pathway
cmy04260  Cardiac muscle contraction
cmy04261  Adrenergic signaling in cardiomyocytes
cmy04270  Vascular smooth muscle contraction
cmy04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102940198 (CACNA1C)
   04020 Calcium signaling pathway
    102940198 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102940198 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102940198 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102940198 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102940198 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cmy04040]
    102940198 (CACNA1C)
Ion channels [BR:cmy04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102940198 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102940198
NCBI-ProteinID: XP_007070870
LinkDB
Position
Un
AA seq 2107 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQ
KKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPE
DDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFS
AILEQATKADGANSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLL
HIALLVLFVIIIYAIIGLELFMGKMHKTCYLVQGIYDAPAEEDPSPCAPQSAHGRQCQNG
TVCKAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLV
IFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDP
ENEDEGMDEEKPRNMSMPTSETESVNTDNVAGADIEGENCGARLAHRISKSKFSRYWRRW
NRFCRRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTA
EMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFK
ITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTF
DNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFL
AIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKPAMEEETKEEKIELKSI
TADGESPPTTKINVDDYQPNENEEKNPYPTTEAPAEEEEEEPEMPVGPRPRPMSELHLKE
KAVPMPDASAFFIFSPTNRFRLHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHYSFR
NQILFYFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSS
AINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQ
LFKGKLYSCSDSSKQTEAECRGHYISYKDGEVTHPMIQPRNWENSKFDFDNVLTAMMALF
TVSTFEGWPELLYKSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTF
QEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLI
LLSTICLAMQHYGQSCPFKQAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFL
IVIGSIIDVILSETNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTL
LWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTDINRNNNFQTFPQAVLLL
FRCATGEGWQDIMLACLPDKKCDPESEPTNSTEGDHSCGSSFSIFYFISFYMLCAFLIIN
LFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLG
FGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAII
KKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNAL
SLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSY
YQSDGRSSFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINN
ANNTALSRFPSPPSYPSTVSTVEGHGTPLSPTIRVQEAPWKLTSKSSSSRDSQLAIVCQE
EVSQDETYDENLNEDLEYCSEPSLISTEMLSYQDDENRQLTPPENNKGEGSKLSPKSGFL
RSSSLGRRASFHLECLKRQKNQGVDVTQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTTF
SPRLCATPPAMPCSRGWPQKTIPTLRLDGVESGEKLNSSFPSIHCSSWYSDSTSCRSPRR
ARPASLTVPSQTGGSSRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMT
IEEMENAADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNPDCRKSQEELQDS
RIYVSSL
NT seq 6324 nt   +upstreamnt  +downstreamnt
atgaatgccaacgcagctgcagggcttgccccagagcatatccctactccaggggcagct
ctgtcatggcaggctgctatcgatgctgccaggcaggccaaattgatgggtagtgctggc
aatgcaacaatatccacagctagctccacgcagaggaaacgacagcagtatgggaaacag
aaaaaacagggtacaaccacagctacacgtcctccccgggcattgctgtgtttaacgctg
aaaaatcccatccggagggcatgcatcagcatcgtcgaatggaaatcatttgaaataatt
attttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaa
gatgattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataatt
tttacggtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaatgct
tacctccgcaatggctggaatttactagattttataattgtggtggtagggctttttagt
gcaattttagaacaagcaaccaaagcagatggggcgaattcaataggagggaaaggtgcc
ggatttgatgttaaagcactgcgggctttccgagtgttacgccccttacgactggtatct
ggagttcctagtctccaagtggttttaaattccattatcaaggctatggtccccttgctg
cacattgccctgctggtgctgtttgtcataattatctatgccatcattggactggagcta
ttcatggggaagatgcacaagacctgctacttagtgcaaggcatttatgatgcacctgca
gaagaggacccctctccttgtgctcctcaatcagcgcatggacggcagtgtcagaatggc
actgtgtgcaaagcaggatgggaggggcccaagcatggcattaccaatttcgacaacttt
gcctttgccatgttaactgtgtttcagtgcatcactatggagggctggacagatgtcctt
tactggatgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctggtc
atctttggatcctttttcgttctaaatctggttcttggtgtgttgagcggggagttttcc
aaagaaagagagaaggcaaaggctcggggtgactttcagaagttgcgggagaaacaacag
ctggaggaagacttgaaggggtacctggattggataactcaagcagaagacattgatcca
gaaaatgaagatgaaggcatggatgaggagaagccccgaaacatgagcatgcctacaagt
gagactgagtctgtgaacacagacaatgtggcaggagcagatattgaaggagaaaactgc
ggtgctaggctggcgcatcggatctccaaatctaagtttagccgctactggcgccggtgg
aacaggttctgcaggaggaagtgccgagccgctgtcaagtccaatattttctactggctg
gtgatcttccttgtgtttctcaacacccttaccattgcctctgaacattacaaccagcca
gactggctcacagaggtccaagacactgccaataaggtgctgctagctcttttcacggca
gagatgctgctgaagatgtacagcttaggtctccaggcctactttgtatctctcttcaac
cgctttgactgctttattgtttgtggaggaatcctggagaccatcctggtggagaccaag
atcatgtcaccgctgggcatctcggtgttgagatgcgtccgcctcctgagaatatttaaa
atcacaaggtattggaactccttgagtaacctagtggcttcactgctgaactcagtccgc
tccatcgcttcccttttgctgcttctcttcctcttcatcatcatcttctcgctcctggga
atgcagctctttgggggcaagtttaactttgatgagatgcaaaccaggaggagcacgttc
gataacttcccccagtccctcctcactgtgtttcagatcctgactggggaggactggaat
tcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtc
tgtatttacttcatcatcctcttcatctgcggaaactatatcctgctgaatgtgttcttg
gccatcgctgtggacaatcttgccgatgcagagagtttgacatctgctcagaaagaagag
gaagaggaaaaagaaaggaaaaaactagctaggaccgctagtcctgaaaagaaacaggag
attgagaaaccagctatggaggaggagacaaaggaggagaaaattgagctgaaatcgatc
actgctgatggagagtccccacctactaccaagatcaatgtggatgattatcagcccaat
gaaaatgaagagaagaacccatatcctactacagaagctccagcagaggaagaggaggag
gagcctgaaatgcctgtcggccctcggccacgcccaatgtctgaactgcacctcaaagag
aaggctgtgcccatgccggatgccagtgcttttttcatcttcagccctaccaacaggttt
cgtctccactgccatcgaatcgttaatgataacattttcaccaacctgatcctctttttc
atcttgctcagcagcatctccctggcagctgaggaccctgtccgacactactcctttagg
aaccaaattctcttttattttgatatagtttttactgtcattttcaccattgaaattgct
ctgaagatgaccgcatatggagctttcctccacaaaggctccttctgcaggaactacttc
aacatcctagacttgctggtggtcagcgtgtctctcatctcctttgggatccagtccagt
gccatcaacgtagtgaagatcttacgtgtcctgcgagtgctcagaccgctgagggccatc
aacagagccaagggactaaagcacgtggtccagtgtgtatttgtagccatcagaaccatc
ggaaatattgtgatcgtcaccactttgctgcagttcatgtttgcctgcattggagttcag
ttgttcaagggcaaactgtatagctgcagcgatagctccaagcaaacagaagcagaatgc
agggggcattatatttcgtacaaagacggagaggtcacccacccaatgatccagccccgc
aattgggagaacagcaagtttgactttgacaacgtcttgactgccatgatggcactcttc
actgtttcaacctttgagggctggccagagctactgtacaagtccattgattctcacatg
gaggatgtgggacccatctataaccacagggtggagatctccattttcttcattatctat
atcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcattgtcacgttt
caggaacaaggagagcaggaatacaagaactgtgagctggacaagaaccagcgccaatgt
gttgagtatgccctgaaggcccgccccctgcggaggtacatccctaagaaccagtaccaa
tacaaagtgtggtatgtggtgaattccacctattttgagtacctgatgttcgttctcatc
ctgctgagcaccatctgcctggccatgcagcactatggtcagagctgtcccttcaaacaa
gccatgaatatcctcaacatgctcttcacgggtctcttcaccgtcgagatggttctgaaa
ctaattgccttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctc
atcgtaattggcagcattatagacgtcattctcagtgaaactaatccagctgaacatacc
caatgctcttcctctatgaatgcagaggaaaactcgcgcatctcaatcacctttttccga
ctcttccgtgtgatgcgtctcgtgaagctcctgagccgtggggagggcatccggacattg
ctttggaccttcatcaaatccttccaggctctcccctacgtggctcttttaatagtgatg
ttattcttcatctatgcagtgattggaatgcaggtgtttggtaaaattgctctgaatgat
accacggatatcaaccgcaacaacaactttcagacgttccctcaagcagtgctgctactc
ttcaggtgtgccactggtgaaggctggcaggacatcatgcttgcgtgtctgccagacaag
aagtgcgatcccgagtcagagccaaccaactctactgaaggcgaccattcctgtgggagc
agcttttccatcttttatttcatcagcttctacatgctctgtgcctttttgattatcaat
ctttttgtagctgttattatggataactttgactacttgacgcgggactggtccattctg
gggccacatcaccttgacgagtttaaaaggatctgggcagagtatgaccctgaagccaag
ggacggatcaaacacctggacgtggtgacgctgctccggcggattcagcctccgctgggc
tttgggaagctctgtcctcatcgagtagcttgcaaacgcctagtctctatgaatatgcca
ctgaacagtgatgggactgtcatgtttaatgccaccctctttgcgttggtcagaacagca
ctgaggatcaaaactgaaggtaacctggagcaagccaatgaggagctgcgagcgatcatt
aagaaaatctggaagcgcaccagcatgaagctgctggatcaggttgtgcccccggcaggt
gatgatgaggtgacagttgggaagttttatgccactttcctaatccaagagtatttccgg
aaattcaagaaacgtaaagaacaaggcctcgtgggcaaaccctcacagcggaatgctctc
tccttgcaggccgggttgcgcacattgcacgacattgggccagagatccgacgggcgatc
tccggagacctgacagccgaagaggagctagacaaggccatgaaagaagctgtttctgct
gcctctgaagatgatatcttcaggagggctggtggcctgttcggaaaccatgtcagctac
taccaaagtgatggcaggagctcattcccccagacattcaccacccagcgccctttgcac
atcaataaatctggcaacaaccagggagatacggagtccccgtcacacgagaagctagtg
gattccaccttcactcccagcagctactcgtcttcgggctccaatgccaacatcaacaat
gccaacaatactgccttgtcccgctttcccagcccacccagctacccaagtactgtcagc
acggtggaggggcatggcacacccttgtcacccaccatccgagtgcaggaggccccttgg
aaactcacttccaaaagctccagttccagagacagccagctggcaatcgtttgccaagaa
gaagtgtctcaggatgagacttatgatgagaatttgaatgaagacctagagtactgtagc
gaaccaagcctgatctctactgaaatgctgtcataccaagatgatgaaaacagacaactg
actccacctgaaaacaacaaaggggagggctccaagctgtctccaaagagtggatttctt
cgctcttcatcactgggtcgaagagcatcttttcacttagagtgtctgaagagacagaaa
aaccaaggtgtagatgtcacacagaagacagttctgccattgcatctggtacaccatcag
gcactagcagtggcagggctgagtcccctgctccagagaagccattccccaacaacgttc
tccccccggttgtgtgccacgccccctgccatgccctgtagccgtggctggccacagaag
accatcccgactttacggcttgatggagtggagtccggtgagaaactcaacagtagcttc
ccatcaatacactgcagctcctggtactctgacagcaccagctgcagaagccctcggaga
gccaggccagcctccctcaccgtcccgagccagactggggggagcagcaggcagttccac
ggcagcgctggcagccttgtcgaagcggtcttgatttcagaaggactgatgcagtttgct
caagatccaaagttcattgaggtcacaacccaagagctagcagatgcctgtgacatgaca
atagaagagatggaaaatgcagcagacaacatactcaacggtaacagcaagcagagcccc
aatggcaacctcttgccttttgttaactgcagggacccagggcaggacagtgcaggagag
gaagaggaagaggtgcagaacccggattgtagaaaaagtcaggaggagctccaggacagc
aggatttatgtcagcagcctgtag

DBGET integrated database retrieval system