KEGG   Chelonia mydas (green sea turtle): 102940431Help
Entry
102940431         CDS       T02989                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmy03036]
    102940431 (HDAC10)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102940431 (HDAC10)
Chromosome and associated proteins [BR:cmy03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102940431 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102940431
NCBI-ProteinID: XP_007056931
LinkDB All DBs
Position
Un
AA seq 687 aa AA seqDB search
MASGTALIYDDEMTSYKLLWDNPECDIEVPERLLSSYEQLKHYHLLERCVHVPVREGTEE
EIMLVHSSEYLEVVKSTQTMNEEELRRVSGNYDAVYFHPNTYRCAKLAVGATLQLVDSVM
SGKVCNGMALVRPPGHHSQRNAANGFCVFNNVAIAAQYAKRRYGLQRILIVDWDVHHGQG
IQYVFEEDPSVLYYSWHRYEHQQFWPLLRESDYDAVGQGKGKGFNFNVPWNKVGMGNSDY
LAAFFHVLLPVAFEFVPELILVSSGYDSGIGDPEGQMNATPECFAHLTHFLMQLANGRLC
AVLEGGYHLKSLSESVCMTVKTLLRDPLPQISGEMAPCLSAVESIQNVRAAHKPYWKCLM
YEEATPLHNLVTKSKQMMEAELNQTSTHPTAKQVVGKTNSDEAIKIDRFLESHMKKILFP
VPSVKTAAAIVSKADAHLLPISVQVEMEMNAQELKTLVSAFDAELVKEERTLLSLQNVVA
VLDKILKKKVCNGIAESSLASVSTTFALKHCFDFGLQRVLCIVVGDVDLELDLDDGKILL
MNICQKQQTEKTNSKYHISLNWKEDAERNNFFCAVLGFILPVAYSYQPDLMLIVIGPNRS
LGVNGISLLTCLLQGLAESRILVVIQDTEINLVQSVAKALSGVPAPDFGAYAPASQENVL
EIKRLRNQLQQEWKMLRCSVRDWISGS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagctttgatttacgatgatgaaatgacaagttacaaactactttgg
gataaccctgagtgtgatattgaagtgccggaaagattgttatcttcctatgagcaactt
aaacattatcatcttttggaaagatgtgtccatgtacctgtcagggaaggaaccgaagaa
gagatcatgttggttcacagttcagaatacttggaagttgtaaagagcacccagacaatg
aatgaagaagaactccgaagagtctcaggaaattatgatgctgtttactttcatccaaat
acttaccgctgtgctaaactagcagtaggagcaactttgcaactggtggactctgtgatg
tcaggaaaagtgtgcaatggaatggcattagtaaggcctccaggtcatcacagccagcga
aatgcagccaatggattctgtgtgtttaataatgttgccattgcagctcagtatgccaaa
agaagatatggtctccagagaattctcattgttgactgggatgtgcaccatggacaagga
attcaatatgtatttgaagaggatcccagtgttctctattactcctggcatcgctatgaa
catcagcagttctggcccttgctcagagaatctgattatgatgctgttggtcagggaaaa
ggaaaaggattcaatttcaatgtaccttggaataaggttggaatgggaaattcagattat
ctagctgcatttttccatgtgttgcttccagtggcttttgagtttgttccagaacttatt
ctggtctcttctggatatgattcaggaattggtgacccggagggtcagatgaatgctact
ccagagtgttttgcccaccttacacatttcctaatgcagttagctaatggaaggctgtgt
gcagttctagagggtggataccatttgaagtcattgtctgaatcagtctgcatgactgta
aaaactttgcttagagaccctctcccccagatctctggagaaatggcaccgtgcttaagt
gctgttgagtctatacaaaatgtgagagctgcacataaaccatactggaaatgtctgatg
tatgaagaagcaactcctttacacaatctcgttaccaagtcaaaacagatgatggaggct
gagctaaatcaaactagtacacatcccacagcaaagcaagtggttgggaagactaacagt
gatgaagctatcaaaatagacaggtttttggaatcacacatgaaaaaaattctctttcca
gtaccttctgttaaaacagcagcagcaattgtctctaaagctgatgcacatttgctacca
atatctgttcaagtggagatggaaatgaatgcacaagaactgaaaactcttgtcagtgca
tttgatgcagaacttgtgaaggaagagagaactttactctctcttcagaatgtggtggct
gtcctagataaaatactaaagaagaaggtgtgcaatggaattgcagaatcatctctggct
tctgtttctacaacctttgcactaaagcactgctttgattttggattacaaagagtcctc
tgcatagttgttggagatgtggatcttgaactcgatttagatgatggaaaaatacttttg
atgaacatttgccagaaacaacaaactgaaaagaccaactccaaatatcatatttctctg
aactggaaagaggatgctgaaagaaacaatttcttttgtgctgtacttggattcattctt
cctgtagcgtatagctatcaacctgacttaatgttaatagtcattggaccaaacaggagc
cttggtgtaaatgggatttctctgcttacttgtttactgcaaggattagctgagtctcga
attcttgtggtaattcaggacacagaaataaacctagtgcaaagtgtggccaaagcctta
tcaggtgttcctgcacctgactttggagcctatgcacctgcttcccaagaaaatgtactt
gaaataaaacgattaagaaaccaacttcaacaggaatggaaaatgcttcgatgttcagta
agggactggatttctggaagctga

DBGET integrated database retrieval system