KEGG   Chelonia mydas (green sea turtle): 102940507
Entry
102940507         CDS       T02989                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04012  ErbB signaling pathway
cmy04068  FoxO signaling pathway
cmy04110  Cell cycle
cmy04115  p53 signaling pathway
cmy04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102940507
   04068 FoxO signaling pathway
    102940507
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102940507
   04115 p53 signaling pathway
    102940507
   04218 Cellular senescence
    102940507
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102940507
NCBI-ProteinID: XP_007057013
LinkDB
Position
Un
AA seq 153 aa
MEWRSVKANRVRRNLFGPVDHEQLQQDFQHMLRSSMEGAQQKWNFDFLRDMPAEGLLQWE
ELQSHDVPAFYHSCVVGEARKPLKPLNQGIVKEVKAHHFATVTLTENPKVAKKMSGKKSQ
AGKKRRQTSLTDYYSAKKQVKTNSQAAAKNLAF
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagtggaggtcagtgaaggcaaaccgtgtacgaaggaacctctttggccccgtggac
catgaacagctgcagcaggacttccagcacatgctgcgcagcagcatggagggagcccag
cagaagtggaactttgacttcttacgggacatgccagctgaggggctcctgcagtgggaa
gaattacagagccacgatgtcccggccttttaccacagttgtgtggtgggtgaggctcgc
aagcctttaaagcccttgaaccagggtatagtcaaggaggtcaaggctcaccactttgcc
acggtgacactgactgagaaccccaaagttgccaagaaaatgtcgggcaagaagagccaa
gcagggaagaaacgaagacagacatccttgacagattactactcagctaagaagcaagtc
aaaactaacagtcaagctgctgcaaagaatttggctttctga

DBGET integrated database retrieval system