KEGG   Chelonia mydas (green sea turtle): 102940700Help
Entry
102940700         CDS       T02989                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00020  Citrate cycle (TCA cycle)
cmy00190  Oxidative phosphorylation
cmy01100  Metabolic pathways
cmy01200  Carbon metabolism
Module
cmy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cmy_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102940700 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102940700 (SDHB)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102940700 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_18 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 102940700
NCBI-ProteinID: XP_007069351
LinkDB All DBs
Position
Un
AA seq 288 aa AA seqDB search
MAAAVVGVSLKRRVPAMILWAAARQACRGAQTAAAAAPAAQAVAPRIKTFAIYRWDPDKP
GDKPHMQTYEIDLNKCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLA
CTKRIDTNLSKVSKIYPLPHMYVVKDLVPDMSNFYAQYKAIEPYLKKRDESNQGKEQYLQ
SIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLA
QLEDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMSTYKEKAVSA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccgtagtcggcgtctccttgaagcgccgcgtccccgcgatgatcctgtgg
gcggccgcgcggcaggcctgccgtggagcacagacagcagctgcagcagcacccgctgct
caggccgtagcaccacgtatcaagacgtttgctatctacagatgggatccagacaagcct
ggggacaagccgcacatgcagacctatgaaattgatctgaataagtgtgggcctatggta
cttgatgcgctgatcaagataaaaaatgagatggactccactctgaccttccgcagatca
tgtagggaaggcatttgtggctcctgcgctatgaacatcaatggtgggaacaccctggcc
tgtaccaaaagaattgacaccaaccttagcaaggtctccaaaatctaccctctcccccat
atgtatgtggtaaaggatcttgttccggacatgagtaacttctatgctcagtacaaagcc
attgagccttacctgaagaagagggatgaatcgaatcagggcaaagaacagtatctgcag
tctatagaagatcgtcagaaactggacggactctatgagtgcattctatgtgcctgctgc
agtaccagctgccccagttactggtggaatggagacaagtacctgggccctgcggtgctt
atgcaggcatatcgctggatgattgactccagagatgactacacagaagaacgtctggca
cagcttgaggacccattttccctctaccgctgtcataccatcatgaactgcacacagact
tgccccaagggactgaaccctggaaaagcaattgccgaaatcaagaaaatgatgtcaact
tacaaagagaaggcagtcagcgcataa

DBGET integrated database retrieval system