KEGG   Chelonia mydas (green sea turtle): 102941070Help
Entry
102941070         CDS       T02989                                 

Definition
(RefSeq) trypsin I-P38-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102941070
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102941070
Peptidases [BR:cmy01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102941070
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102941070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102941070
NCBI-ProteinID: XP_007068782
LinkDB All DBs
Position
Un
AA seq 264 aa AA seqDB search
MKYILVVAFLGAAVAFPIDDTDDDKIVGGYTCPKNSLLYQASLNIGYHFCGGALINSRWV
VSAAHCYKSSIQVRLGEHNLAVREGTEQFINSAKVIRHQNYSPQMLDNDIMLIKLASAAT
LNPYINTIALPTSCVVTGTQCLISGWGNTLSSGTNYPDLLQCLKAPVLSSSKCSGAYPGQ
ITSNLICIGYLEGGKNSCQGDSGGPVVCNGRFQGIVSWGIGCAQKGYPGVYTKVCSYVSW
IQNTIATEMLSCHVTCTPHFLSHI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcctggttgtagcctttctgggagcagctgttgccttccccattgatgac
actgatgatgacaagatcgtgggaggctacacctgcccaaagaactctttgctctaccag
gcatccctgaacatcgggtaccatttctgtggaggtgccctcattaacagcagatgggtc
gtctcagccgctcactgctacaaatcctctatccaggtgaggcttggagaacacaacctg
gcagtcagggaaggcactgaacagttcattaattcagccaaagtcatccgtcaccagaat
tacagcccccagatgctggacaatgacatcatgctcatcaagctggccagtgcagctacc
ctcaacccctacatcaacacaattgccctgccgaccagctgtgtggtcactggcacccag
tgcctgatctctggctggggcaacaccctcagcagtggcactaactaccctgacctcctg
cagtgcctgaaagctcctgtcctgtcctccagcaagtgcagcggtgcctatccaggacaa
atcaccagtaacctgatctgtatcggatacctggaggggggcaaaaattcctgtcagggg
gattccggtggcccagtagtctgcaatgggagattccaggggattgtctcctggggaatt
ggttgtgcacagaaaggctaccccggggtctacactaaagtgtgcagctatgtctcctgg
atccaaaataccatcgctactgagatgctctcatgccatgtgacatgcacaccccatttc
ctcagccatatatga

DBGET integrated database retrieval system