KEGG   Chelonia mydas (green sea turtle): 102941241Help
Entry
102941241         CDS       T02989                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00010  Glycolysis / Gluconeogenesis
cmy00030  Pentose phosphate pathway
cmy00051  Fructose and mannose metabolism
cmy00052  Galactose metabolism
cmy01100  Metabolic pathways
cmy01200  Carbon metabolism
cmy01230  Biosynthesis of amino acids
cmy03018  RNA degradation
Module
cmy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102941241 (PFKP)
   00030 Pentose phosphate pathway
    102941241 (PFKP)
   00051 Fructose and mannose metabolism
    102941241 (PFKP)
   00052 Galactose metabolism
    102941241 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102941241 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmy01009]
    102941241 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cmy03019]
    102941241 (PFKP)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102941241 (PFKP)
Protein phosphatases and associated proteins [BR:cmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102941241 (PFKP)
Messenger RNA biogenesis [BR:cmy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102941241 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK PP-binding_2
Motif
Other DBs
NCBI-GeneID: 102941241
NCBI-ProteinID: XP_007054192
LinkDB All DBs
Position
Un
AA seq 738 aa AA seqDB search
MFLLSQGYQGMVDGGDNIVEVSWESVSSILQVGGTVIGSARCKEFRTREGRLKAAFNLIQ
RGITNLCVIGGDGSLTGANLFREEWSGLLEELAQSGKIEEEAVKKYVYLNIVGMVGSIDN
DFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADW
VFIPEYPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDSHNKPITSEKVKDMMVSDG
PWSKISDGLSSSWWTNDALITIYHLQQLGFDTRVTILGHVQRGGTPSAFDRILASRMGVE
AVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDERKFCEAVKLRGRSFE
NNLNTYKLLSHRRPDAELPKTNFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHNMFAVID
GFEGFARGQIKEISWGDVGGWTGQGGSLLGTKRTLPAKYLEKIADQMRTYNINALMVIGG
FEAYESCLQLAEARARFEEFCIPICVLPATISNNVPGTDFSIGADTALNAIVEYLANMGG
LAAGADAAYVFEEKFDIRELQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYS
EEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKGKVFANTQ
DSVCLLGMRRRNLLFQPVVDLKDQADFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSG
QLEHVARHSPKEAETGAI
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcttgtctcagggttaccaaggtatggttgatggaggtgacaacattgttgaa
gtgtcatgggaaagtgtttcaagcatcttgcaagtgggagggacagttattggtagcgca
cgctgcaaagaatttcgtacccgggaaggccgtttgaaggcagctttcaacttgattcag
cgtggaatcactaacctttgtgtgattggtggtgatggtagtttaacaggtgctaatctc
tttcgtgaagaatggagtggacttctagaggaactggcacaaagtggcaagattgaagaa
gaagctgtgaagaaatatgtttacctcaacattgtggggatggttggatccatagataat
gacttctgtggcaccgatatgaccattggtactgactcggccttgcacagaatcattgaa
gttgtggatgccatcatgaccactgctcaaagccatcagaggacctttgtcctagaagtt
atgggaagacactgtgggtatctagctcttgttagtgcattagcttgtggtgcggattgg
gtatttattccggaataccccccagaagaaggatgggaggagcagatgtgtgttaagctt
tctgagaaccgtgcacgaaagaaaaggctgaatatcataattgtggcagaaggtgccatt
gattctcacaacaaacctataacttcagaaaaggttaaggatatgatggtatctgatggt
ccttggtcgaaaataagtgatggtctgtcaagttcctggtggactaatgatgcccttatc
acaatttaccacttacagcagctgggatttgatactcgtgtgactatcctgggtcatgtt
caaagaggaggtactccttcagcttttgatagaattttggcaagccgtatgggcgtggaa
gctgtcctggcccttctagaggctacaccagatactcctgcttgtgttgtgtccttgtct
gggaaccaagctgtccgtctgcctttaatggagtgtgtgcagatgactcaagaagtacag
aaagcaatggatgaaagaaagttttgtgaagctgtcaaacttcgtggaaggagctttgaa
aacaaccttaacacctacaaattattgtctcatagaagaccagatgcagaacttccaaag
actaattttaatgtggcagttttaaatgtaggtgcccctgcagccggtatgaatgctgcc
gtccgatccgcagtaagagttggcataactgaaggtcacaacatgtttgctgtcattgat
ggatttgaaggctttgctagaggccagataaaggaaatcagctggggagatgttggaggt
tggactggacaaggagggtcgcttcttggcacaaaacgtaccctccctgcaaagtatttg
gagaagattgctgaccagatgcgcacttataacatcaacgcccttatggttattggtgga
tttgaggcctatgaaagttgtctgcaattagctgaagcacgtgctcgctttgaggagttt
tgcattcctatctgtgtgttgccagctactattagcaacaatgtgccaggcaccgacttt
agcattggtgctgacactgccctgaatgctattgtggagtacctggccaatatggggggc
cttgctgcaggtgcggatgctgcttatgtctttgaagagaaatttgatattcgagaactc
caggctaatgtggagcatttgaccgaaaagatgaaaaccagcatccagcgtggtctagtg
ctgaggaatgagaacagcaatgagaattacacaactgactttatctaccagctctattct
gaggaaggaaaaggtgtgttcgattgcagaaagaatgtattgggccacatgcagcagggt
ggagcaccttccccatttgacaggaactttgggacaaaaatctctgcaaaagctgtacag
tggatctcaaagaaactgaaagaaacataccgaaaaggaaaagtgtttgccaacacccag
gactccgtttgtttgctaggaatgcgcagacgcaatcttcttttccaacctgtggttgat
cttaaggatcaagcagattttgtgcacagaattcctaaggaacagtggtggctgaaactt
cgacctctgatgaaaattctggccaaatacaagactagctacgatgtttcagattcaggt
caactagagcatgtagctaggcacagcccaaaagaagcagaaactggagccatctaa

DBGET integrated database retrieval system