KEGG   Chelonia mydas (green sea turtle): 102941326Help
Entry
102941326         CDS       T02989                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmy01002]
    102941326 (TMPRSS9)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102941326 (TMPRSS9)
Peptidases [BR:cmy01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102941326 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102941326
NCBI-ProteinID: XP_007059698
LinkDB All DBs
Position
Un
AA seq 1094 aa AA seqDB search
MDQTDLALKPTADIQRVRLAAHSTCCCKVTIATALVGGSLLLSLGIIMAYCSAQELSFEH
TVEVRGIAYDSSLKRENSDYYRTLTPALQRLFLASFQGSSLEGSCVGCAVLEYRYGNSSV
IVHFRLQFSPQASWSLSASVEEEALRHGLAAALRKEGIPLASYGIISSALLIGKCQSPVT
EMDLTVMFQSGSCPGNVFTCQNSQCVWKENPECDGRVDCSDGSDEAGCDCGSRPTMQTAH
RIVGGTEASRGEFPWQVSLRENNEHFCGATILTEKWLVSAAHCFNEFQDPAVWAAYMGTI
SLSGSDSSTVKASVGRIIPHPSYNTDTADFDVAVLELDSPVPFNKYIQPACLPGPGHRFP
AGRKCLISGWGYLKEDFLVKPETLQKATVELLDQALCASLYSHTLTDRMICAGYLEGKID
SCQGDSGGPLVCEEPSGKFFLAGIVSWGIGCAEAKRPGVYAQVTQLRDWILDAISTFPTP
AALTVPMTLSSTNGDAATMEGISNSTMSKHRPVSSTLSAPTASKPATASWPQECGGQPGL
SKPSKIVGGIEASKGEIPWQVSLKEGSRHFCGATVIGERWLLSAAHCFNQTKLEYLKAYL
GTTSLTGADGNAVKVSIKKVVQHPSYNPIILDFDVAVLELASPLHFNKYIQPVCLPLAVQ
KFPVGKKCMISGWGNIREGNVTKPESLQKASVSIIDQKTCSVLYNFSLTDRMICAGFLEG
RVDSCQGDSGGPLACEETPGLFYLAGVVSWGIGCAQAKRPGVYSRITKLKEWIIDAISSK
PNPSSGAGTSPSTVTARTSTTSSSPAQPSSNEAATSPVSQITSKPATTPRKTTTAAPKTT
GVARPNQLPDCGTTPAVAFSKIVGGSGAAKGEWPWQVSLWLRRKEHKCGAVLIADKWLLS
AAHCFDIYSDPKMWVGILGTPFLSGTDGRLEKIFRIYKHPFYNGYTLDYDVALLELATAV
RFTGAIKPICLPDNSHIFRDGARCFITGWGATKEGGIMSKHLQKAAVNVIGDQACKKFYP
IQISSRMVCAGFPQGTIDSCLGDAGGPLACKEPSGRWFLAGITSWGYGCARPYFPGVYTK
VTAVRGWIRQNLKL
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaacggacctagctctaaagccaacggcagacatacagagggtgagattggcg
gcacacagcacctgctgctgtaaggtaaccatcgcgactgcactcgtgggtggctctctt
ctcctttccctgggcattataatggcttattgctctgcacaagagctcagctttgagcac
accgtggaagtgagaggaattgcatatgacagcagtctaaaaagggagaactcggactac
tacaggactttgacccccgctctgcaaaggctgtttctagccagcttccaaggctcttca
ctggaagggagctgtgttggctgtgctgtcctggagtacaggtatgggaactccagtgtg
attgtccatttccggctgcaattcagccctcaggcttcctggtctttaagcgccagtgtg
gaggaagaggccctcagacatgggttggctgcagcactgaggaaggagggcatcccgctg
gccagctatgggatcatctcctcggccttactcataggtaaatgtcagagtcctgttaca
gagatggatctgactgtgatgttccagtcaggcagttgccctggaaatgtatttacttgt
cagaacagccagtgtgtttggaaagagaatcctgagtgtgacggccgagtcgactgctcc
gacggctctgacgaggcaggctgcgactgtgggagccgccccaccatgcagacagcccac
agaatcgtgggtggcaccgaggcttccagaggggagttcccgtggcaagtcagcctgagg
gagaacaacgaacacttctgtggtgcaactatcctcactgagaagtggctggtgtctgcg
gctcactgcttcaacgagtttcaggacccagcggtctgggcagcctacatgggaaccatc
tccctcagcggctcagacagcagcaccgtgaaagccagcgtgggccgcattatcccacat
ccctcctacaacaccgacactgcggacttcgatgtggctgtgctggagctcgacagcccc
gtgccctttaacaagtatatccagcctgcgtgcctgccaggccctgggcaccgcttccca
gctggcaggaagtgcctcatctctggctggggttatctcaaggaagacttcttggtgaaa
ccagagaccttgcagaaggcgacagtggagctgctggaccaggccctgtgtgccagtctg
tacagccacaccctgaccgacaggatgatatgtgccggctacctggaggggaagatcgac
tcctgccagggtgactctggcggccccttggtttgtgaagagccatctggcaagtttttc
ctggctggtatcgtgagctggggaattggctgtgctgaagcgaagcggcctggggtctat
gcccaagtgacccaactccgagactggatccttgatgctatctccaccttccccacacct
gcagccctcaccgtcccaatgacactttccagcacaaacggtgatgctgccaccatggag
gggatcagcaacagcaccatgagcaaacacagacctgtgtcctccaccttatcagcaccc
actgccagcaagccagctactgcttcttggccgcaagagtgcggtgggcaacctgggctt
tcaaaacccagcaagatcgtgggaggaattgaggcttccaaaggagaaatcccctggcag
gtcagcctgaaggaggggtcgaggcacttctgtggggccactgtcattggggagcgctgg
ttgctgtcggcagctcactgcttcaatcagacaaagctggaatatctgaaagcctacctg
ggcaccacatccttaactggtgcagatggcaacgcggtgaaagtcagtataaagaaagtg
gtgcagcacccctcctacaaccccatcatcctggacttcgacgtggctgtgctagaactg
gctagcccccttcatttcaacaagtacatccaacctgtgtgcctcccgttagctgtgcag
aagtttcccgttggcaaaaagtgcatgatttctggatggggaaacatcagagaaggcaac
gtcacgaagcccgagagcctgcagaaagcttctgtcagcatcattgaccagaagacctgc
agtgttctctacaacttctccctcactgaccggatgatctgtgcaggcttcctggagggg
agggttgactcgtgccagggggactcgggcggcccgctggcctgtgaggagaccccgggc
ttattctacctggccggtgttgtaagctgggggattggctgtgctcaggctaagaggccg
ggggtgtactctagaataaccaaactcaaggagtggatcatagatgccatctcatccaag
cccaaccccagctctggagcaggcacctcgcccagcacggtaactgccagaacctccacc
acaagcagctccccagcccagcccagcagcaacgaggcagccaccagcccagtcagccaa
attaccagcaagccagctactacccccaggaaaaccaccactgctgctccaaagaccaca
ggggttgccaggcccaaccagctcccagattgcggcacgacccctgccgtggccttcagc
aagatagtgggtggcagcggagcagccaagggcgagtggccctggcaggtcagcctctgg
ctgcggcggaaggagcacaagtgtggggccgtcctcattgctgacaaatggctgctctca
gcagctcattgcttcgacatctacagtgaccccaagatgtgggtgggcattctggggaca
cccttcctgagtggcacggacgggaggttggagaaaatcttccgcatctacaagcacccg
ttctacaacggctacacactggactacgacgtggcactgctggagctggccacagctgtg
cggttcaccggtgccatcaagcccatctgcctcccggacaattcccacatcttcagggat
ggggcacgctgtttcatcacaggttggggtgccaccaaggaaggaggcatcatgtccaag
cacctgcaaaaggccgcagtaaatgtaattggcgaccaggcctgcaagaaattctacccc
atccagatcagcagcaggatggtgtgtgccggcttcccgcagggcaccatcgacagctgc
ttgggcgatgcaggtggccccttggcctgcaaggaaccctcagggcgctggtttctagct
ggaatcacaagctggggctatggctgtgcaaggccttacttccctggcgtttacaccaaa
gtcaccgccgtccggggctggatcaggcagaacctcaagctgtga

DBGET integrated database retrieval system