KEGG   Chelonia mydas (green sea turtle): 102941584
Entry
102941584         CDS       T02989                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00230  Purine metabolism
cmy01100  Metabolic pathways
cmy04020  Calcium signaling pathway
cmy04114  Oocyte meiosis
cmy04261  Adrenergic signaling in cardiomyocytes
cmy04270  Vascular smooth muscle contraction
cmy04371  Apelin signaling pathway
cmy04540  Gap junction
cmy04912  GnRH signaling pathway
cmy04914  Progesterone-mediated oocyte maturation
cmy04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102941584 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102941584 (ADCY3)
   04020 Calcium signaling pathway
    102941584 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102941584 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102941584 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102941584 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102941584 (ADCY3)
   04916 Melanogenesis
    102941584 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102941584 (ADCY3)
   04270 Vascular smooth muscle contraction
    102941584 (ADCY3)
Enzymes [BR:cmy01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102941584 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 102941584
NCBI-ProteinID: XP_007066982
LinkDB
Position
Un
AA seq 1143 aa
MPGNRAFSEPEYSAEYSADYSVSLPSDPERGVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVVYTTDKLATILVASVGLAAHIL
LFVLCKYGLLPDRISRKFMPYVLWILIAAQIFCYLGLNFSHFHEASDTVGWQAFFVFSFF
ITLPLRLMPIVLITAVSCSIHTLVLGVTIAQQQQGAINGEALLRQILSNVAIYLCTITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAHELVKLLNELFARFDKLAAKHHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTKTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQNTMDCLKGEFEVEPGEGGSRCE
YLKEKGIVTYLIVVPKQPLKNGINGLSLTSSHGNSPLLINTKECNGSINTTCTTPDEAEE
LDTRVVNPSFPNPRRRLRLRDLAERVVDASQNEQELNNLLNEALLERESVQALKGKYTYR
LSMRFINPEMETRYSVEKEKQSGAAFSCSCMVLFFTALVEILIDPWLVANYVTFVTGEIL
LLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMADIVDMLSCLQF
YSSTSNSTAGTLLAGGCVEDPKYYSFIAVLALIASIMLVQVSHMVKLTLMVMITGAVGVV
NIYAWQQIFDEYDKERFQENVLPRYAGCHGMGGNPAMVGXTWLIHLSFGRSTLVPSKYSM
TVMVFIMMLSFYYFSRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVAR
HFLGSKKRDEELYSHSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDAL
LDDPQFRCITKIKTIGSTYMAASGVTPDVNTNGYNTTIKKEELSEKERWQHLADLADFAL
AMKVTLMNINYQSFNNFMLRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMG
NIQVVEETHLVLKEYGFRFMRRGTIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVV
DSS
NT seq 3432 nt   +upstreamnt  +downstreamnt
atgcccgggaacagggccttctctgagccggagtactcggccgagtactcggctgactac
tcggtcagcctaccctccgaccctgaacgtggggtgggccggacccatgaggtgacggtg
aggaactcaggctcatgcctctgcctgccgcgcttcatgcggctcaccttcgctcccgag
tccctggagaacctctaccagacttacttccgccggcagcgccatgagaccctcttggtg
ctggtggtcttcgctgccctcttcgactgctatgtcatcgtcatgtgcgctgtggtctac
accaccgacaagctggccaccatcctggtggcctcagtgggcctggccgcccatatcttg
ctcttcgtcctatgcaagtacgggctcctgccggaccgcatctcccgcaagttcatgccc
tatgtcctctggattctcatcgctgcccagatattctgctacctgggcctcaacttttcc
cacttccacgaggccagtgacacagtgggctggcaggccttcttcgtcttctccttcttc
atcaccttgcctctgcgcctcatgcccattgtgctcatcacggccgtctcctgcagcatc
cacaccctggtgctgggggtcaccattgcccagcagcagcagggcgccatcaacggagag
gccttgctacggcagattctgtccaatgttgccatctacctgtgcaccatcactgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaagcacggcag
tctctcgaggtcaaactcaacctggaggaacaaagccagcagcaggaacggctgatgctt
tccatcctgcccaagcacgtggcagatgagatgctaaaggacatgaagaaggacccgagc
cagaaagagatgcagcagtttaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctctttgctgacatagttggcttcacccagctgtcatcctcctgcagcgcccatgagctg
gtgaagctgctgaatgagctctttgcccgcttcgacaaactggcagcgaaacaccaccag
ctgcgcatcaagatcctcggagactgctattactgtatctgtgggctgccggactaccgc
gaggaccacgccgcctgctccatcatgatgggactggccatggtggaagccatatcctac
gtgcgagagaagaccaagacggacgtggacatgcgggtgggggtccacagcggcacagtg
ctgggtggcgtgctgggccagaagcgctggcagtatgacgtgtggtccacagatgtcacg
gtggctaacaagatggaggccggtggcatccctgggcgtgtgcatatctcccagaacacc
atggactgcttgaaaggggagtttgaggtggagcccggtgagggggggtcaaggtgcgag
tacctgaaggagaaggggatcgtcacgtacctcattgtggtacccaagcagcccctcaag
aacgggatcaacggactgtccctgacgtcctcccatgggaactccccgctgctgatcaac
accaaggagtgtaacggcagcatcaacaccacctgcaccacgcccgacgaggctgaggag
ctggacaccagggtggtgaacccctccttccccaacccccggcggcgcctgcgcctgcgt
gacctggccgagagagtcgttgacgcctcgcagaacgagcaggagctcaacaacctgctc
aacgaagccctgctggagagggagtctgtgcaggcgctgaaggggaagtacacctaccgc
ctctccatgcgtttcatcaacccggagatggagacgcgctactccgtggagaaggagaag
cagagcggggccgccttcagctgctcctgcatggtgctcttcttcaccgccctggtggag
atcttaatcgatccctggctggtggccaattatgtgacgtttgtaactggagagatcctg
ctgctcatcctgactctctgctccctggccgccattttccccagggtatttcccaaaaaa
cttgtagccttttccacttggatcgacaggacccggtgggcccggaacacatgggccatg
tcagccatctttatcctcaccatggctgacattgtggatatgctcagctgcctgcagttc
tactccagcaccagcaacagcaccgcggggaccctgctggcggggggctgcgtggaggac
cccaagtattacagcttcattgccgtgctggccctcatcgccagcatcatgctggtgcag
gtcagccacatggtcaagctcaccctgatggtcatgatcaccggggccgtgggtgtggtc
aacatctatgcctggcagcagatcttcgacgagtacgataaggaacgcttccaggagaac
gttctgccccgatatgctggctgccatggaatgggaggcaacccagccatggtgggatga
acatggctcattcatctctccttcggcaggtccaccctggtcccctccaagtactccatg
acagtgatggtcttcatcatgatgctcagcttctactacttctctcgccacgtggagaag
ctagccaggacattgttcctgtggaagatcgatgtccatgaccagaaggagcgggtgtac
gagatgaggcgctggaacgaggctctggtcaccaatatgttgccggagcatgtggcccgg
catttcctgggctctaagaaacgggacgaggagctgtacagccattcgtatgacgaaatt
ggcgtcatgtttgcctccctcccaaactttgctgacttctacacggaggagagtatcaac
aacggcgggatcgagtgcctgcgcttcctcaacgagatcatctcggacttcgacgcgctc
ctggatgatccccagttccggtgcatcaccaagattaaaactattggaagcacctacatg
gctgcttctggagtcacccctgatgtcaataccaatggctacaacaccaccataaagaaa
gaggagctctcggagaaggagcgttggcaacacttagctgatttggccgactttgcctta
gccatgaaagtgaccctgatgaacattaactaccagtccttcaacaacttcatgctccga
ataggcatgaataaaggggcggtgctggcaggagtgatcggtgcccgcaaaccacactat
gacatttgggggaacacggtgaatgtggccagcaggatggagtcaacaggcgtgatgggg
aacatccaggtggtggaggagacccatctcgtcctgaaggaatacgggttccgctttatg
cgccgggggaccatctacgtcaaaggcaaaggggagttgctgaccttcttcctgaagggc
cgggagaagcagggctcttttgtcaatggctcctcagtgactcttccgcaccaggtggtc
gacagctcatga

DBGET integrated database retrieval system