KEGG   Chelonia mydas (green sea turtle): 102941795Help
Entry
102941795         CDS       T02989                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmy01002]
    102941795 (TMPRSS2)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102941795 (TMPRSS2)
Peptidases [BR:cmy01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102941795 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 SRCR Ldl_recept_a Trypsin_2 DUF3149
Motif
Other DBs
NCBI-GeneID: 102941795
NCBI-ProteinID: XP_007064535
LinkDB All DBs
Position
Un
AA seq 485 aa AA seqDB search
MAVNSGLPPYYENHGYQPENIYISRQPVDANVYPPYYPPSVPHYVPRVPAHQSAPPVVQP
KPPSAKLCTSKVKKTLCIVLSVAIILSVSIIAAMLIWYFEANSCSGSSIVCGSSGTCVSP
SQWCDGVVHCSNGEDENQCVRLYGPNFILEVYSSVSKSWYPVCQDDWNDDYGKIACKDMG
YNVKSYYYSQGITHERGSTNFMRLNRSAGNIDLYKKLYNSDYCASGKVVSLRCIECGLSR
KNVNPSGRIVGGSAAKLKEWPWQVSLQVQGSHVCGGSIITPEWIVTAAHCVEGQLSSPYY
WRVYAGILTQKEMRERSGSRVQNIISHPNYDSDSKDNDVALMKLQTSLSFTDTVAPVCLP
NPGMMFQPNQQCWVSGWGAEHQGGKSSGVLNAVMVPLIQRSRCNSASFYNGLVLPTMICA
GYLEGGKDSCQGDSGGPLVTEKNSVWWLVGDTSWGTGCASRGKPGVYGNMTMFTDWIYRN
MQANR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaactcagggctaccaccttactatgaaaatcatggttatcagccagaaaac
atctatatttccagacagcctgtggatgctaacgtgtatccaccatattatcctccatca
gtgccacattatgtcccaagagttcctgctcatcagtcagctcccccagtagtacagcca
aagccgccatcagcaaaactgtgcacgtcaaaagttaagaaaactctatgcatcgtttta
tccgttgcaataatactgtcggtttccataattgcagctatgcttatctggtattttgag
gccaatagctgttctggctcatcaatagtgtgtggatcttcaggaacatgtgtgtcacca
tctcagtggtgcgatggagtggtccactgttccaatggtgaagatgaaaaccaatgtgtt
agactctatggaccaaattttatcctggaggtctattcatctgtcagcaaatcctggtat
ccagtatgtcaagatgactggaatgatgactatggaaagatagcttgtaaagacatggga
tataatgtaaagtcttattactatagtcaaggaataacacatgaaagaggttctacaaac
tttatgaggttgaatagaagtgctgggaacatagatctatacaaaaaactgtataacagt
gactattgtgcgtctggaaaagtggtatctctgcggtgcatagagtgtggcttatcccgt
aaaaatgtgaatccttcaggcagaattgtgggtggaagtgctgcaaagctgaaggaatgg
ccatggcaggtcagccttcaagtccaaggctcccatgtatgtggaggctccattatcacc
cctgaatggatagtgacagctgctcactgtgtagaaggacagctttcttctccatactac
tggagagtgtatgctgggattctgacgcaaaaggaaatgcgcgagagaagtggatccagg
gtgcagaacataatttcccacccaaattatgattcagattctaaagacaatgatgttgcc
ctgatgaagttacagacatcgctgagttttactgacactgtagcacctgtttgtttgcct
aaccctggaatgatgttccaacctaatcaacagtgctgggtatctggatggggagcagaa
caccaagggggtaaaagttcaggtgtcttgaatgccgtaatggtgcctttaatacaacgt
tctagatgtaattctgccagtttctataatggcttagttttgcctaccatgatatgtgct
gggtatctggaaggaggaaaggattcctgccagggtgacagtggaggtccgttagtaact
gagaaaaactcagtgtggtggctagttggtgacacaagctggggaactggctgtgccagt
cgcggaaaacctggagtgtatggaaatatgacaatgttcactgactggatttatagaaat
atgcaggcaaatagatga

DBGET integrated database retrieval system