KEGG   Chelonia mydas (green sea turtle): 102942977Help
Entry
102942977         CDS       T02989                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00480  Glutathione metabolism
cmy00980  Metabolism of xenobiotics by cytochrome P450
cmy00982  Drug metabolism - cytochrome P450
cmy00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102942977 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102942977 (MGST2)
   00982 Drug metabolism - cytochrome P450
    102942977 (MGST2)
   00983 Drug metabolism - other enzymes
    102942977 (MGST2)
Enzymes [BR:cmy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102942977 (MGST2)
Transporters [BR:cmy02000]
 Other Transporters
  Pores ion channels [TC:1]
   102942977 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG Sugar_transport
Motif
Other DBs
NCBI-GeneID: 102942977
NCBI-ProteinID: XP_007062890
LinkDB All DBs
Position
Un
AA seq 147 aa AA seqDB search
MAGDLILLAAVSLLSACQQSHFAWLVGKSRKQHKIMPPEVTGTPEFDRIFRAQQNCVEFY
SIFLVALWIAGWFFKQELAALLGLVYMYTHHKYFHGSAEPAKGRITGFYWSVVVLLSLMA
LAAAGITNSFLEEYLDISIGKKLHKLL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgatttaattttgcttgctgcagtatcccttctttcagcctgccagcaaagt
cattttgcctggcttgtaggaaaatcaagaaagcagcacaagatcatgcccccagaagtc
accggaaccccagaatttgacagaatattccgtgcacaacaaaactgtgtggagttttat
tcaatcttcctggttgctctttggattgcaggctggtttttcaaacaagaattggctgcc
cttctgggtctggtgtacatgtacacccatcacaaatacttccatggaagtgcagagcct
gcaaaaggaaggataacaggtttttactggagtgtggtggttctgctctcactgatggcc
ctggctgcagctgggattactaatagctttctggaagaatacttggacatcagcatagga
aagaaattacataaattgctctga

DBGET integrated database retrieval system