KEGG   Chelonia mydas (green sea turtle): 102943137Help
Entry
102943137         CDS       T02989                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04110  Cell cycle
cmy04114  Oocyte meiosis
cmy04120  Ubiquitin mediated proteolysis
cmy04914  Progesterone-mediated oocyte maturation
Module
cmy_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102943137 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102943137 (CDC23)
   04114 Oocyte meiosis
    102943137 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102943137 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cmy04121]
    102943137 (CDC23)
   03036 Chromosome and associated proteins [BR:cmy03036]
    102943137 (CDC23)
Ubiquitin system [BR:cmy04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102943137 (CDC23)
Chromosome and associated proteins [BR:cmy03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102943137 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_16 TPR_11 TPR_7 ANAPC3 TPR_17 TPR_12 DUF772 TPR_9
Motif
Other DBs
NCBI-GeneID: 102943137
NCBI-ProteinID: XP_007065039
UniProt: M7AZE9
LinkDB All DBs
Position
Un
AA seq 589 aa AA seqDB search
MGKMAAPAVVPGLGSCDFSDLREIKKQLLSVAERSRERGLQHSGKWASELAFALDPLPLS
ELPAAPALTEEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEK
KKDDETVDSLGPLEKGQVKNEALRELRVELSKKHKAQELDGFGLYLYGVVLRKLDLVKEA
IDVFVEAAHVLPLHWGAWLELCNLITDKEMLKCLSLPDTWMKEFFLAHIYTELQLIEEAL
QKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLY
VRSMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAW
TLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQL
RPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQ
CYIKYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTREEGKA
LLRQILQLRNQGETSSTEISAPFFLPASLSSNNTPTRRVSPLNLSSVTP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatggcggctcctgccgttgtgcccggtttgggaagctgcgatttctccgac
ttgcgcgagatcaagaagcagcttctgagcgtggcggagcggagccgcgagcgtggcctg
cagcacagcgggaaatgggcctctgagctggcgtttgccctggatcctctgcctctgagc
gagctgcctgcggctcctgcgctcacagaggaggatgctcgtgatttggatgcttacaca
ttagctaagtcttatttcgatctgaaggagtatgacagggccgcatactttctgcgggga
tgcaagagccagaaggcctacttcttgtacatgtactccagatacctgtcaggagaaaag
aagaaagatgatgaaacagtggatagtctgggccccttggagaaaggacaggtgaagaat
gaagcactaagagagctaagggtggagcttagcaaaaaacacaaagcacaggagctggat
ggttttggcctttatctgtatggcgttgtgctgcggaagctggacctggtgaaagaggcc
attgatgtgtttgttgaagctgcccatgttttgcctttgcactggggagcctggctggag
ctctgtaatctgatcacagacaaagagatgctgaagtgcctgtccttgccagacacctgg
atgaaggagttcttcctggcgcacatttacacagagctgcagctgatagaagaggctctg
cagaagtaccagagtctcattgatgcaggattctccaagagcacctacatcatttcccag
atcgcagttgcctaccacaatatcagagatatagacaaagctctctctatcttcaatgaa
ctaaggaaacaagacccatacaggatagaaaacatggacaccttctccaacctgctgtat
gtccggagcatgaagcctgagctgagctacctggctcacaatctgtgtgagattgacaag
tatcgtgtggagacctgctgtgtgataggaaattactatagtctacgctctcagcatgaa
aaagcagcactttatttccagagagccttgaaactgaatcctcggtatcttggagcctgg
accctcatgggacatgagtacatggaaatgaagaacacatctgcagctatccaggcttat
agacatgcaatagaggtgaacaagagggactacagagcctggtatggactggggcaaacc
tatgagatcctcaagatgccattttactgtctgtattactaccgacgggcccaccagctg
aggcccaatgattcccgtatgctggttgctctgggagagtgttatgagaaactcaatcag
ctggtggaagccaaaaagtgttattggagagcttatgctgtgggagatgtggagaaaatg
gcattggtgaaactagccaagctgcatgaacagctgaatgaatcagaacaggctgctcag
tgctacatcaaatacatccaggatatctattcctgtggggagatagtggagcacctggag
gtgagcactgccttccgctacctagcccagtattacttcaagtgtaaactctgggatgaa
gcctctgcctgtgctcagaaatgctgtgcattcaatgatacaagagaagaagggaaggcc
ctgctgagacagattttacaactacgcaaccaaggggaaacctcctctacagagatctct
gctcccttcttcctccctgcatcgctgtcatccaacaacactcccacacggagagtatcc
ccactcaacctgtcttcagttacaccatga

DBGET integrated database retrieval system