KEGG   Chelonia mydas (green sea turtle): 102943548Help
Entry
102943548         CDS       T02989                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00020  Citrate cycle (TCA cycle)
cmy00190  Oxidative phosphorylation
cmy01100  Metabolic pathways
cmy01200  Carbon metabolism
Module
cmy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cmy_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102943548 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102943548 (SDHA)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102943548 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4
Motif
Other DBs
NCBI-GeneID: 102943548
NCBI-ProteinID: XP_007058969
LinkDB All DBs
Position
Un
AA seq 551 aa AA seqDB search
MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEEAPAAVVELENYGMPFSRTEEGKIYQRAF
GGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRG
VIALCIEDGSIHRLRAKNTVVATGGYGRTFFSCTSAHTSTGDGTAMVTRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTIEIRE
GRGCGPEKDHVYLQLHHLPPQQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYKGQVITHVNGKDQVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAE
SCKPGESVPSIKPNAGEESVANLDKLRFANGNIRTSELRLNMQKTMQSHAAVFRTGSVLQ
EGCEKLSHIYRDLDDLKTFDRGIVWNTDLVETLELQNLMLCAMQTIYGAEARKESRGAHA
REDYKVRVDEYDFSKPIQGQQKRPFEEHWRKHTLSYVDVKTGKVTLRYRPVIDKTLNEED
CATVPPAIRSY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagataactggagatggcacttctatgacactgtgaaaggatctgactggctg
ggagaccaggatgccattcattacatgactgaggaggcacctgctgcagttgtagagctg
gaaaattatggaatgccgtttagcagaacagaagaagggaagatctatcagcgtgccttt
ggtggacagagccttcaatttggaaaagggggacaggctcatcgatgctgttgtgtcgcg
gacaggacaggacactcactgttgcatacactgtatggcaggtccttacgatatgatacc
agctattttgttgagtattttgccttggacctcctgatggaaaatggagaatgtcgtgga
gttattgcactttgcatagaagatggctcaatacatcgtttaagagcaaagaacactgtt
gtagccactggtgggtatggccgcaccttcttcagttgcacatctgctcataccagcaca
ggtgatggtacagctatggtcacacgagctggccttccttgccaggacttagagtttgta
cagttccaccctacaggtatctatggtgctggttgtcttattacagaaggttgtcgtggt
gaaggaggtattcttattaacagtgaaggtgaaagatttatggagagatatgcacctgtt
gctaaggatctggcttccagagatgtagtgtctcgttctatgaccattgaaatccgtgaa
ggaaggggctgtggccctgaaaaagaccacgtatatttgcagttgcaccatttaccacca
cagcagctagcaatgcgcctccctggaatttcagaaacagctatgatatttgctggtgtg
gatgtcacaaaagagcctattcctgttcttcctactgtgcattacaatatgggaggtatt
cctactaactacaaagggcaggtaattacacatgtgaatggcaaagatcaagtagtacct
ggcttgtatgcttgtggtgaagcagcctctgcatctgttcatggtgctaatcgacttgga
gcaaactctcttttggacttggtggtctttggtcgtgcttgtgcccttagtattgcagaa
tcatgcaagcctggagaatcggttccctcaattaaaccaaatgctggagaagaatctgtt
gcaaatcttgacaaactacgatttgccaatggaaacataagaacatcagaactgaggctt
aatatgcaaaagacaatgcaaagccatgctgcagtgttccgaacaggctcagtactacag
gaaggctgtgagaaactcagccacatttatcgtgatttggatgatctgaagacatttgac
agaggtattgtgtggaatactgacttagtggagaccttggaactgcaaaatttgatgctg
tgtgctatgcaaactatttatggtgctgaggctcggaaagaatctcgtggtgctcatgcc
agagaagactacaaggtaagagtagatgaatatgatttttccaagccaatccaagggcaa
cagaaaagaccatttgaagagcattggagaaaacacaccctttcttatgtggatgtcaag
actgggaaggttactttgagatacagacctgtaattgacaaaactttaaatgaagaagac
tgtgcaacagttccacctgctattcgttcctactaa

DBGET integrated database retrieval system