KEGG   Chelonia mydas (green sea turtle): 102943895Help
Entry
102943895         CDS       T02989                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102943895 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmy03036]
    102943895 (DOT1L)
Enzymes [BR:cmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102943895 (DOT1L)
Chromosome and associated proteins [BR:cmy03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102943895 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 102943895
NCBI-ProteinID: XP_007070498
LinkDB All DBs
Position
Un
AA seq 1715 aa AA seqDB search
DKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQ
LWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQM
IDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMK
WYGKKHAEYTLERGDFLSEEWKERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIV
SSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFS
SLKNPKLREEQEAARRRQQRENKSNTTTPTKVRENKVNSLLNILHKKHDSGAEEEKVGTN
AVKKTSPSKARKKKLSKKGRKMAGRKRGRPKKMNTANTERKTKKNQTALELLHAQTVSQT
PSSSPQDAYKSPHSPYYQLPPKVQRHSSNQLLVTPTPPALQKLLDSFKIQYMQFMAYMKT
PQYKANLQQLLEQEKEKNAQLLGTAQQLFTHCQAQKEEIKRLFQQKLDELGVKALTYNDL
IQAQKEISAHNQQLKEQTKQLEKDNSELRNQSLQLLKARCEELKLDWSTLSLESLLKEKQ
ALKNQISEKQKHCLELQISIVELEKSQRQQELMQLKSYMPPDESLSVQLRNKNRLSREPE
ADHGRFQLELECSKFPMPHINGMSPELSMNGHATPYEIHNALSRPSSKQNTPQYMTSHLD
QEIIPCTPNHSSRQKVDKTAGLSLPDYTRFSPAKIALRRHLNQDHAVNGKATTNEIHQRA
DHVKENGLTYPSPGISNGIKLSPQETRPSSPAALPIAGEKVLRERTSASNGETITSLPIS
IPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSPVHQNRDSSSTLEKQYGASSHNGVSN
AAGNKSLALATSGFSYSSGSMAVNGTLSNSPAHLNHSVDQAAVDDSGSLFNSVGSRSSTP
QYPSLLMMQSRNSGQNSPAHQHSASPKLNGASQSMVGVLQYVDAQKMFTEGTKGELQPDA
AFSDPENEAKRRIIFTISPSTGSVKQSPSNKHSPLTASIRMDCGQAYMQDGKKRGRRKRS
STGNLNMNSGVSPKRKSLPTVAGLFAQPSGSPLNINSMVNNINQPLEITAISSPENSLKN
SPLPYQDNDQPPVLKKEKPLIQTNGVLIFFFSTRIERKIATISLESKSPQKTIENGGSLA
GRRQAQTSENMNSSKWKSTFSPISDINLTKTTDSPLQAVSSLSQNSLFAFRPSSEDGMAI
DAKLAAHTRKNITMSSSGTDGLSPNTNSVNGSMYNGGLTTDIGLHSFIDGASLPHKTSDV
TTLNSSLGFQSQRSKDVGIMETNPFLNKRQLEGLGSMKGEDLNRSGVKSKEISELTIRPG
ASSEKGSLQHNGKVGKGRDRDVEFKNGHNLFISAAAVSSGGLLNGKSLSTGVSSAGNPAP
SVQTHHPFLNTLTTASQFPLGPMALQANLNSVTNSSVLQSLFNSMPAAASLVHVSSAATR
LTNSHAMGNFSPGVTGGTVGGIFNHAVPSASSSHQFGASFSSSAVSSSTMLSLNPLQAVA
STSSFQSPSSSLVTSSENRAAQHLNRAPVQSVFHTPTPPPPNVSLPPPPPLLASNSEPAL
LQNLPSIPANDAFLPSSSAASVQSANASLSIKLASLQHKTSRPSFTVHHPPLPRLALAQT
APMIPQSNATGTSAMWVTLGMQSPYASHLSGVKPR
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
gacaaacaccatgatgctgctcatgaaatcattgagacaattcggtgggtctgtgaagaa
atcccagatctcaagcttgctatggaaaattatgttttaattgactatgatacaaaaagc
tttgaaagcatgcagaggctttgtgacaaatacaaccgcgccattgatagcattcatcag
ttgtggaaaggaaccacccagcccatgaaactgaacactcgtccctccaatgggctcctc
cgtcacatcttgcagcaagtatataaccactcggtgacagacccagagaaactcaacaac
tatgagcccttttccccagaggtgtatggagagacttcctttgatctagtggcccaaatg
attgatgagattaaaatgactgaggatgacttgtttgttgacttgggcagtggtgtgggt
caggtagtgcttcaagtcgctgctgccacaaactgcaaacatcactatggtgtggagaaa
gctgatattccggccaaatatgctgagacgatggacagagagttcagaaagtggatgaaa
tggtatgggaaaaaacatgcagaatacacactggaaagaggtgacttcctctccgaagaa
tggaaagaaagaattgcaaacacaagtgttatttttgtgaataattttgcctttggtcct
gaggtggatcaccaactgaaggagcgatttgcaaacatgaaggaaggtggcagaatcgtg
tcctcaaagccttttgcacctctaaactttagaataaacagtcgaaacttgagtgatatt
ggcactataatgagagttgtggagttatcaccactgaaagggtcggtttcatggaccggg
aaaccagtttcttactacctgcatactattgatcgcaccatacttgaaaactatttttct
agtctcaaaaatccaaaactcagggaggaacaagaggcagctagacgtcgtcagcaaaga
gaaaacaagagcaacacaactactccaacgaaggtgcgagaaaacaaggtcaactccctc
ttgaatattttacacaaaaaacatgattctggtgctgaagaagaaaaagttgggacaaat
gcagttaaaaagacatctccctccaaagcacgcaagaaaaagctgagtaagaaaggaagg
aaaatggcagggcggaagcgagggcgtcccaagaaaatgaacactgcaaatacagagcgc
aagaccaagaagaaccaaactgcactagagcttctgcatgctcaaactgtgtctcagaca
ccctcatcctctcctcaggatgcatacaagtcacctcatagtccatattaccaactacct
cctaaagtgcaacggcattcatctaaccaactgttggtgactcctaccccacctgcacta
cagaagctgctagactcttttaagatccagtacatgcagttcatggcgtacatgaaaact
cctcagtacaaagcaaacctgcaacagttactggagcaggaaaaggaaaagaacgctcag
ttgctggggacagcacaacagttattcacccactgccaggcacagaaagaggaaattaaa
cggctctttcaacaaaagctcgatgagttgggagttaaggctctgacatataatgacctg
attcaggctcagaaagagatctctgctcacaaccagcagctgaaggaacagacaaagcag
ctggagaaagataacagtgaactcaggaaccagagcttgcagctgcttaaagcacgatgt
gaagaactgaagttggattggtcaacgctgtcattggagagcttactgaaggaaaagcag
gcactgaagaatcagatttctgagaaacaaaagcactgtttggaattgcagatcagcatt
gtggagcttgagaaaagtcaaaggcagcaggagctcatgcagctgaaatcgtatatgcct
cctgatgagtctctgtcggtacaactacgcaataaaaaccgtttaagccgtgagcccgag
gccgatcatggcagattccaacttgagcttgagtgctctaaatttcctatgccccacatc
aatggcatgagccctgaactgtccatgaatggccatgctactccctatgaaattcataat
gctcttagcaggccctcttccaagcagaacacccctcaatacatgacctctcacctggac
caagaaataattccttgcaccccaaaccacagcagcagacagaaggtggacaagacagca
ggcttgtccttacctgattacaccaggttttccccagctaagatagccctaaggagacac
ttgaatcaggaccatgcagtcaatggaaaagcaacaactaatgagatacaccagagagct
gaccatgtaaaagagaatggccttacatatccaagccctggcatttcaaatggcataaag
ctgagtcctcaggaaactcggccctcttccccagcggccttacccattgcaggcgagaag
gttttgcgagagaggacttctgcgagtaatggagaaactatcaccagtctacctatcagt
attcctctcagcacggtgcagcccaataaactccctgttagtatccctctggccagcgta
gtcctacctagccgtgttgagaaggtgagaagcacacctagtccagttcatcagaatcga
gactcgtcgtcaacacttgaaaaacagtatggtgctagttctcataatggcgtaagcaat
gctgctggaaataagtcactggctttggctacctcaggtttttcttattcttctggctcc
atggcagttaatggaacactttcaaacagcccagcccaccttaaccatagtgtcgatcag
gcagctgtggacgactccgggagtttgtttaactcggtagggtctcggagctccactcca
caatacccttctttgctaatgatgcagtcacggaactctgggcagaactccccggctcac
cagcactcagcaagccccaagttaaatggtgcctctcagagcatggtaggggttctgcag
tatgtggatgctcagaagatgtttaccgaaggaacaaagggggaacttcagcctgatgcc
gccttttcagatcctgagaacgaggccaagagaagaatcattttcacaatctctcctagt
acaggaagtgtaaaacagtctccttctaacaagcacagtcccctgactgcaagcattcgg
atggactgtggccaagcatacatgcaggatgggaagaaacgaggtcgaaggaagagatcc
tccaccgggaatctaaacatgaactctggggtgtcccctaaacgcaaatccttaccaact
gtggctggactctttgctcagccttcaggctcaccgcttaatataaactcaatggtcaat
aacattaatcagcctttagaaataacggccatttcctcccctgaaaactccctgaagaac
tctcctcttccctaccaggacaatgaccagcctccagtgttgaaaaaagagaagcccctg
attcagaccaacggcgttctaatctttttcttttctactagaattgagaggaaaattgca
acgatatcattggaaagcaaatctccacagaagactattgaaaatggtggcagtttagct
gggaggagacaagcacaaaccagtgagaacatgaatagcagtaaatggaagtctaccttt
tcaccaatttctgacatcaacctgaccaaaactacagatagcccattgcaggctgtttca
tctctgagccagaattccctgtttgcctttaggccgtcctctgaggatggcatggccatc
gatgccaaacttgcagcacacacaaggaaaaacatcaccatgtcctcctctgggacggac
ggactcagccccaatacaaactccgttaatggatccatgtataacggtggactgaccaca
gacatcggtttacacagctttattgatggtgcttctcttcctcataagacttcagatgtg
acgaccctcaactcctctctgggttttcagtcacagaggagcaaagatgtggggattatg
gagacaaacccctttttgaacaagaggcagcttgaaggcctaggcagcatgaaaggagaa
gacttaaaccggtcaggagtcaaaagtaaagagatcagtgaattaaccattcgtccaggg
gcttcttctgaaaaaggttccttgcagcacaatggcaaggtcggcaaaggacgggaccgt
gatgtggagtttaaaaatggccacaaccttttcatttctgctgctgctgtatcttctggt
ggccttcttaatggcaaaagcctttccactggtgtctcatctgcaggcaacccagcacct
tctgttcagacgcaccatcctttcttaaacacattgaccactgcatcgcagttccccctg
ggccccatggctttgcaggcaaacctcaactcggtcacaaactcctcagtattgcagtcc
ttatttaattcaatgccagctgctgccagtctggtccacgtgtcatcagctgcaaccaga
ctgactaactctcatgctatggggaacttctctcctggggttacaggtggaacagttgga
ggtatttttaaccatgcggtgccttctgcctcctcttctcatcagtttggagccagtttc
agcagcagtgctgtttctagcagcacaatgctaagcttaaaccctctgcaggctgttgcc
agcacgtcatccttccagtccccctcctctagcttagtaacatccagtgagaacagagct
gcccaacacctgaacagagcgccagtgcaatctgtttttcatacccctactccaccccct
cctaatgtttcattaccccctcctcctccattactcgcttctaactctgagcctgcgctc
ctgcagaacttgccgtccatcccagctaatgatgcttttttaccatcctcttctgctgct
tctgtccaatctgctaatgcttctttgtctattaagctagcttctcttcagcacaaaact
tcccgtccctcctttacagtccatcacccacctctgccccgtttggcgctggcacagacc
gcgcccatgatcccgcagtccaacgcaactggcacgtccgctatgtgggttacacttggc
atgcagtctccttatgcttcgcacctttctggggttaagccacgataa

DBGET integrated database retrieval system