KEGG   Chelonia mydas (green sea turtle): 102944417Help
Entry
102944417         CDS       T02989                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00500  Starch and sucrose metabolism
cmy01100  Metabolic pathways
cmy04910  Insulin signaling pathway
Module
cmy_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102944417 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102944417 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmy01003]
    102944417 (GYS2)
Enzymes [BR:cmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102944417 (GYS2)
Glycosyltransferases [BR:cmy01003]
 Polysaccharide
  Storage polysaccharide
   102944417 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 102944417
NCBI-ProteinID: XP_007071275
LinkDB All DBs
Position
Un
AA seq 795 aa AA seqDB search
MPLVRSLSVTSLNGLPQWEDEDLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKITIDEWG
ENYFLIGPYFEHNVKTQVEVCEPPNPAIKKAVDTLKGQGCQVFFGRWLIEGSPYVMLFDI
GSAAWNLDRWKGEFWDACNIGIPFSDREANDALIFGSLTAWFFKELSSQFDDKPNLIAHF
HEWQAGAGLILSRFRKLPVATVFTTHATLLGRYLCAASIDFYNKLDQNHIDAPQELGLEV
TQEHPETQPFPFPEAEEFDSSKEGGINIQALHKETKNLKELCRCNRLTYKLSTGIATSTT
EIQPPLAGNPQVFNSTQQNDEIVQGGKLSPNCPQLSSNVVPSTAAEISPEPNFSNSEDVY
LCLFFAFPDVVTPNGLNIKKFSAMHEFQNLHAMYKARIQEFVRGHFYGHLDFNLARTLFF
FIAGRYEYSNKGADLFLEALSRLNFLLRVHRSDVTVVVFFIMPAKTNNFNVETLKGQAVR
KQLWDTAQCVKEKFGKKLYDALLKGEIPDLNKILDRDDVTIMKRAIFSTQRQSLPPVTTH
NMIDDSNDPILNTIRRIGLFNNRTDRVKVILHPEFLSSTSPLLPMDYEDFVRGCHLGVFP
SYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVADPAAYGIYIVDRRYRSPDESCNQ
LTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWRYLGRYYMHARHLALSRTFPDKFEMEPN
APPKTEGFRYPRPSSVPPSPSVSQHSSPHHSEDEDEDERYDEDKEAERDRQNIKSPFSLG
ALPQGKKKQYGEYRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggttagatcactgtctgtgacctctcttaatgggcttcctcagtgggaggat
gaagacctgccagtggaggatttattgctctttgaagtcgcttgggaagttaccaataaa
gttggtggcatctacactgtgatccagacaaaagccaaaattacaattgacgaatggggt
gaaaattattttctgattggtccctactttgagcacaatgtgaagactcaggtagaggtg
tgcgagcctccgaacccggcaattaaaaaggcagtggacaccttgaaaggccaagggtgt
caggtattttttggaagatggctgatagaaggcagcccgtatgttatgctctttgacata
ggatcagcagcctggaatctggacagatggaaaggagaattctgggatgcatgcaacata
ggaatcccttttagtgacagagaggccaacgatgcactgatctttggatcgttaactgcc
tggttctttaaagagctctccagtcagtttgatgacaagcccaacttgattgctcacttt
catgaatggcaggcaggcgctgggctaatcctctctcgatttaggaaacttcctgttgcc
acagtctttactacccatgccacgctgctcgggaggtacctgtgtgcagcaagtatagat
ttctacaacaaacttgaccagaaccatattgatgcccctcaagaacttggtctagaagtc
acgcaagagcatccagaaacacaacctttcccatttccagaagctgaagaatttgatagc
agcaaggaagggggaatcaatattcaagcgttgcataaagaaacgaaaaacctaaaagag
ctttgcagatgtaacagactgacatataagctatccacaggaattgcaacatctaccact
gaaattcagccacctctggctggaaatcctcaggtgtttaacagtacacagcaaaatgat
gaaattgttcagggcggaaaactttctccaaattgtccacagctttcctcaaatgtggta
cccagtactgcagctgagatctcaccagaaccaaatttctcaaactctgaagatgtctat
ctctgccttttctttgcttttccagatgttgttactccaaatggcttgaatattaagaaa
ttttcagcaatgcatgagtttcagaatttgcatgccatgtacaaggctaggatccaagag
ttcgttcgaggccatttctatggccatcttgacttcaaccttgcaaggaccttgtttttc
ttcatcgctgggagatacgaatattcaaacaaaggagctgatttgtttctagaggcctta
tccagattaaacttcctgctgcgggttcacagaagtgatgttacagtcgtagtgttcttc
atcatgccagcaaagacgaacaatttcaatgtggaaacactgaaaggccaggcagtacga
aagcaactctgggacaccgcacaatgtgtgaaagaaaaatttggaaagaaactctacgat
gcactactgaagggagaaattccagatttgaacaagatccttgaccgggatgatgtaacc
attatgaaaagagccatcttttcaactcagcgacagtctctacctccagtgaccacccac
aacatgatcgatgattccaatgacccgatcctcaataccatccggcgcattggactcttc
aataaccgcacagacagagttaaggtgatattacacccagagttcctgtcttcaacaagt
ccattattacccatggactatgaagattttgtcagaggctgccatttgggggtgtttccc
tcatactatgagccttggggttatactccagctgaatgcactgtgatgggcattcccagt
gtgaccacaaacctctctggatttggctgtttcatgcaggagcatgtagctgacccagct
gcttatggcatttacatagttgacaggaggtaccgctctcctgatgagtcatgtaaccag
ctgactcagttcttgtatggattttgccagcagtcacggcgtcagaggatcatccagaga
aatcgaactgagaggctctcagacctactggattggagatatttaggaaggtactacatg
catgccaggcacctggctctgagcagaactttcccagataaatttgagatggaaccaaat
gctccaccaaagacggaaggtttcaggtaccccaggccttcatcagtaccaccatcgcct
tctgtctctcagcattccagccctcatcatagcgaggatgaagatgaggatgaaagatac
gatgaggataaagaggccgaaagagacaggcaaaacataaagtcacctttttccctcgga
gcactgccacaaggaaagaaaaagcagtatggagaatataggaactga

DBGET integrated database retrieval system