KEGG   Chelonia mydas (green sea turtle): 102944629Help
Entry
102944629         CDS       T02989                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102944629 (TGM1)
Enzymes [BR:cmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102944629 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102944629
NCBI-ProteinID: XP_007065459
LinkDB All DBs
Position
Un
AA seq 640 aa AA seqDB search
MEGMLVVSGVDLMGQRSGATRRAHHTDEFEYDELIVRRGPPFATRLQLQQPYDPELHRVC
LELLVGPTPQVSKATHILVPVGAPLPGLGWAAEVRDSSSNSLSLRVSTAPTAVIGKYRFS
VKTRSRAGEYQMPFDPRNEIYILFNPWCRVLRCFGIATRTVTNYNSAHDTDVSLTMDVYF
DENMKPLERLNADSVWNFHVWNDCWMTRPDLPSGYEGKQGGIFCCGPCSVEAIKRGQVYL
KYDAPFIFAEVNSDKVYWQRQADGTYKIVYVEEKAIGHLISTKAVGSHQRHDITDLYKHP
EGSEAERQAVETAARHGTKAHIYKNKEWGEDVSLSVETSEAIMGQDVSIQVALSNRGSSS
HSVALSLHLAPMFYTGVTGSTFKQESRQVQIPPGGAQSVRMVVSYAEYQPHLVDQAALML
SGWGKVAQTGQVLAKQHSFRLRTPDLTLTVLGPAVVGKETQVQVVFKNPLPQTLTGAVFH
MEGSGMSSPKVLGPAVVGKETQVQVVFKNPLPQTLTGAVFHMEGSGMSSPKATTIGASRL
LPPAQTPRDLRLVGEAQETFRELVLGLLRDRQRRETYVEASYQRTRHNTLIPTFSDHLDP
QQVPWLLPSRDPAPSRGGSSPAPRHSCVSLRRVPHKASYW
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggaggggatgctggtggtgagcggcgtggacctgatggggcagcgctcgggggcaacg
cgccgagcccaccacacggacgagttcgagtacgatgagctgatcgtgcgccgggggccg
cccttcgccacccgcctgcaactgcagcagccctacgaccccgagctgcaccgggtctgc
ctggagctgctcgtcggtcccacgccccaggtgtccaaggccacccacatcctggtgccg
gtgggggccccgctgcctgggctgggctgggcagccgaagtgagggactccagcagcaac
agcctgtccctgcgggtcagcaccgcccccaccgccgtcatcggcaaataccgcttcagc
gtcaagacccggagccgggcaggcgagtaccagatgcccttcgacccccgcaacgagatc
tacatcctcttcaacccctggtgccgcgtcctgcggtgctttgggatcgccacccgcaca
gtcaccaactacaactcagcccacgacacggacgtcagcctcaccatggacgtctacttc
gacgagaacatgaaaccgctggaacggctcaacgccgactccgtctggaatttccacgtg
tggaacgactgctggatgacccggcccgacctgccctcagggtatgaagggaagcaaggg
ggtatcttctgctgcgggccctgctcggtggaggccattaagagagggcaggtgtatctg
aagtacgacgcgcccttcatctttgctgaggtgaacagcgacaaggtgtactggcagcgc
caggccgatggcacctacaagatcgtctacgtggaggaaaaggccatcgggcacctgatc
agcaccaaggccgtgggctcacaccagcgtcacgacatcaccgatctctacaagcaccct
gagggctcggaagccgagcggcaagcggtggagacggcggcacggcacggcaccaaggca
cacatctacaagaacaaggagtggggcgaggacgtgtcgctgagcgtggagacctccgag
gccatcatgggccaggacgtgagcatccaggtggccctgagcaaccggggcagcagcagc
cacagcgtggccctcagcctgcacctggcccccatgttctacacgggcgtgacggggagc
accttcaaacaggagagccggcaggtgcagatcccgccgggaggagcccagtccgtccgc
atggtggtgtcctatgccgagtaccagccccacctcgtggaccaggcggccctcatgctc
agtggctgggggaaggtggctcagaccgggcaggtactcgccaagcagcacagcttccgc
ctgcgcacgccggacctgacgctcacggttctgggcccagctgtggtgggcaaggagacc
caggtgcaagtcgtcttcaagaacccactgccccagacgctgacgggtgctgtcttccac
atggaggggtcggggatgtccagccccaaggttctgggcccagctgtggtgggcaaggag
acccaggtgcaagtcgtcttcaagaacccactgccccagacgctgacgggtgctgtcttc
cacatggaggggtcggggatgtccagccccaaggccacaaccataggggcctcacgtctg
ctgccccccgcccagaccccccgggacctgcgcctggtgggagaagcccaggagaccttc
cgggagctggtgctggggctgctgagagacaggcagcgtcgggagacctacgtggaggcc
agctaccagcgcacgcggcacaacaccctgatccccaccttctccgaccacctggacccc
cagcaggtgccctggctgctgccctcccgggaccctgccccctctagggggggcagctcc
cccgccccacggcacagctgtgtcagcctccggagggtgccccacaaagcctcttattgg
tga

DBGET integrated database retrieval system